ARL3 Antibody

Images

 
Western Blot: ARL3 Antibody [H00000403-B02P] - Analysis of ARL3 expression in transfected 293T cell line by ARL3 polyclonal antibody. Lane 1: ARL3 transfected lysate(20.02 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: ARL3 Antibody [H00000403-B02P] - Analysis of purified antibody to ARL3 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARL3 Antibody Summary

Immunogen
ARL3 (NP_004302.1, 1 a.a. - 182 a.a.) full-length human protein. MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
Specificity
ARL3 - ADP-ribosylation factor-like 3,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ARL3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against transfected lysate in WB. It has been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARL3 Antibody

  • ADP-ribosylation factor-like 3
  • ARFL3ADP-ribosylation factor-like protein 3
  • ARF-like 3

Background

ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009094-M01
Species: Hu
Applications: WB, ELISA, IP
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13407
Species: Hu
Applications: IHC, IHC-P
NBP2-49680
Species: Hu
Applications: WB, IHC
NBP1-72058
Species: Hu
Applications: WB, PEP-ELISA
NBP2-34951
Species: Hu
NBP2-31820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for ARL3 Antibody (H00000403-B02P) (0)

There are no publications for ARL3 Antibody (H00000403-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL3 Antibody (H00000403-B02P) (0)

There are no reviews for ARL3 Antibody (H00000403-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARL3 Antibody (H00000403-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARL3 Products

Bioinformatics Tool for ARL3 Antibody (H00000403-B02P)

Discover related pathways, diseases and genes to ARL3 Antibody (H00000403-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL3 Antibody (H00000403-B02P)

Discover more about diseases related to ARL3 Antibody (H00000403-B02P).
 

Pathways for ARL3 Antibody (H00000403-B02P)

View related products by pathway.

PTMs for ARL3 Antibody (H00000403-B02P)

Learn more about PTMs related to ARL3 Antibody (H00000403-B02P).
 

Research Areas for ARL3 Antibody (H00000403-B02P)

Find related products by research area.

Blogs on ARL3

There are no specific blogs for ARL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL3
Entrez
Uniprot