Recombinant Human ARHGAP25 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARHGAP25 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-458 of Human ARHGAP25 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSFSSMVRCREPSCFHWVLPLVQAIPCKACSRVAIWGVLGDAVAVGAAATDSSEHTLKAWPLSKSSFYWHL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ARHGAP25
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARHGAP25 Protein

  • KAIA0053
  • KIAA0053
  • Rho GTPase activating protein 25
  • rho GTPase-activating protein 25
  • Rho-type GTPase-activating protein 25

Background

ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-44073
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
NBP2-38235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57680
Species: Hu
Applications: ICC/IF
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-15452
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
H00009938-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ARHGAP25 Recombinant Protein (H00009938-P01) (0)

There are no publications for ARHGAP25 Recombinant Protein (H00009938-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP25 Recombinant Protein (H00009938-P01) (0)

There are no reviews for ARHGAP25 Recombinant Protein (H00009938-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGAP25 Recombinant Protein (H00009938-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARHGAP25 Products

Bioinformatics Tool for ARHGAP25 Recombinant Protein (H00009938-P01)

Discover related pathways, diseases and genes to ARHGAP25 Recombinant Protein (H00009938-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP25 Recombinant Protein (H00009938-P01)

Discover more about diseases related to ARHGAP25 Recombinant Protein (H00009938-P01).
 

Pathways for ARHGAP25 Recombinant Protein (H00009938-P01)

View related products by pathway.

PTMs for ARHGAP25 Recombinant Protein (H00009938-P01)

Learn more about PTMs related to ARHGAP25 Recombinant Protein (H00009938-P01).

Blogs on ARHGAP25

There are no specific blogs for ARHGAP25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARHGAP1 Antibody
NBP1-85724

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARHGAP25 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP25