Recombinant Human ARHGAP24 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARHGAP24 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-653 of Human ARHGAP24 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQKKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ARHGAP24
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARHGAP24 Protein

  • DKFZP564B1162
  • Filamin-A-associated RhoGAP
  • FilGAP
  • FILGAPRCGAP72
  • FLJ33877
  • p73
  • p73RhoGAP
  • RAC1- and CDC42-specific GTPase-activating protein of 72 kDa
  • RC-GAP72
  • Rho GTPase activating protein 24
  • rho GTPase-activating protein 24
  • RhoGAP of 73 kDa
  • Rho-type GTPase-activating protein 24
  • Sarcoma antigen NY-SAR-88

Background

ARHGAPs, such as ARHGAP24, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB6798
Species: Hu
Applications: WB, ICC
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-24737
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
H00083478-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ARHGAP24 Recombinant Protein (H00083478-P01) (0)

There are no publications for ARHGAP24 Recombinant Protein (H00083478-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP24 Recombinant Protein (H00083478-P01) (0)

There are no reviews for ARHGAP24 Recombinant Protein (H00083478-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGAP24 Recombinant Protein (H00083478-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARHGAP24 Products

Bioinformatics Tool for ARHGAP24 Recombinant Protein (H00083478-P01)

Discover related pathways, diseases and genes to ARHGAP24 Recombinant Protein (H00083478-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP24 Recombinant Protein (H00083478-P01)

Discover more about diseases related to ARHGAP24 Recombinant Protein (H00083478-P01).
 

Pathways for ARHGAP24 Recombinant Protein (H00083478-P01)

View related products by pathway.

PTMs for ARHGAP24 Recombinant Protein (H00083478-P01)

Learn more about PTMs related to ARHGAP24 Recombinant Protein (H00083478-P01).

Blogs on ARHGAP24

There are no specific blogs for ARHGAP24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARHGAP24 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP24