Novus Biologicals products are now on bio-techne.com

ARHGAP17 Recombinant Protein Antigen

Images

 
There are currently no images for ARHGAP17 Protein (NBP1-83870PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ARHGAP17 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARHGAP17.

Source: E. coli

Amino Acid Sequence: KQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARHGAP17
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83870.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARHGAP17 Recombinant Protein Antigen

  • DKFZp564A1363
  • FLJ10308
  • FLJ13219
  • FLJ37567
  • FLJ43368
  • MGC87805
  • MST110
  • MSTP038
  • MSTP066
  • MSTP110
  • NADRIN
  • neuron-associated developmentally regulated protein
  • PP367
  • PP4534
  • Rho GTPase activating protein 17
  • rho GTPase-activating protein 17
  • RhoGAP interacting with CIP4 homologs 1
  • RhoGAP interacting with CIP4 homologs protein 1
  • Rho-type GTPase-activating protein 17
  • RICH-1
  • RICH1B
  • RICH1MST066
  • WBP15

Background

RICH1 is a GTPase-activating protein (GAP). GAPs stimulate the intrinsic GTP hydrolysis of small G proteins, such as RHOA (MIM 165390), RAC1 (MIM 602048), and CDC42 (MIM 116952).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85724
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-88830
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00057522-M03
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-88831
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NB300-952
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1354
Species: Hu
Applications: Flow, IF, PEP-ELISA
NBP2-72429
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-89732
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12294
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-46290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-36551
Species: Hu, Mu
Applications: IP, WB
H00009322-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-83870PEP
Species: Hu
Applications: AC

Publications for ARHGAP17 Protein (NBP1-83870PEP) (0)

There are no publications for ARHGAP17 Protein (NBP1-83870PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP17 Protein (NBP1-83870PEP) (0)

There are no reviews for ARHGAP17 Protein (NBP1-83870PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ARHGAP17 Protein (NBP1-83870PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARHGAP17 Products

Blogs on ARHGAP17

There are no specific blogs for ARHGAP17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Rhodopsin Antibody (4D2)
NBP2-59690-100ug

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ARHGAP17 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP17