Recombinant Human Argonaute 3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Argonaute 3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 100 of Human EIF2C3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EIF2C3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Argonaute 3 Protein

  • AGO3argonaute 3
  • argonaute3
  • eIF2C 3
  • eIF-2C 3
  • Eukaryotic translation initiation factor 2C 3
  • eukaryotic translation initiation factor 2C, 3
  • FLJ12765
  • hAgo3
  • MGC86946
  • protein argonaute-3

Background

EIF2C3 - eukaryotic translation initiation factor 2C, 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
AF6548
Species: Hu, Mu
Applications: IHC
NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-57022
Species: Hu
Applications: WB, ICC/IF
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24590
Species: Mu
Applications: WB, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81442
Species: Hu
Applications: IHC, IHC-P
NBP2-31855
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-28751
Species: Hu, Mu
Applications: WB, IB, IP
NBP1-77139
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for Argonaute 3 Partial Recombinant Protein (H00192669-Q01) (0)

There are no publications for Argonaute 3 Partial Recombinant Protein (H00192669-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Argonaute 3 Partial Recombinant Protein (H00192669-Q01) (0)

There are no reviews for Argonaute 3 Partial Recombinant Protein (H00192669-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Argonaute 3 Partial Recombinant Protein (H00192669-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Argonaute 3 Products

Bioinformatics Tool for Argonaute 3 Partial Recombinant Protein (H00192669-Q01)

Discover related pathways, diseases and genes to Argonaute 3 Partial Recombinant Protein (H00192669-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Argonaute 3 Partial Recombinant Protein (H00192669-Q01)

Discover more about diseases related to Argonaute 3 Partial Recombinant Protein (H00192669-Q01).
 

Pathways for Argonaute 3 Partial Recombinant Protein (H00192669-Q01)

View related products by pathway.

PTMs for Argonaute 3 Partial Recombinant Protein (H00192669-Q01)

Learn more about PTMs related to Argonaute 3 Partial Recombinant Protein (H00192669-Q01).

Blogs on Argonaute 3

There are no specific blogs for Argonaute 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDX6 Antibody
NB200-191

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Argonaute 3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2C3