Recombinant Human Apolipoprotein B/ApoB Protein Summary
| Description |
A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-100 of Human APOB partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
APOB |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Apolipoprotein B/ApoB Protein
Background
This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Dr, Hu, Mu
Applications: WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
Species: Mu
Applications: Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for Apolipoprotein B/ApoB Partial Recombinant Protein (H00000338-Q01) (0)
There are no publications for Apolipoprotein B/ApoB Partial Recombinant Protein (H00000338-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Apolipoprotein B/ApoB Partial Recombinant Protein (H00000338-Q01) (0)
There are no reviews for Apolipoprotein B/ApoB Partial Recombinant Protein (H00000338-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Apolipoprotein B/ApoB Partial Recombinant Protein (H00000338-Q01) (0)
Additional Apolipoprotein B/ApoB Products
Research Areas for Apolipoprotein B/ApoB Partial Recombinant Protein (H00000338-Q01)
Find related products by research area.
|
Blogs on Apolipoprotein B/ApoB