Recombinant Human Apolipoprotein B/ApoB Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Apolipoprotein B/ApoB Peptides and Proteins

Order Details


    • Catalog Number
      H00000338-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Apolipoprotein B/ApoB Protein Summary

Description
A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-100 of Human APOB partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Protein/Peptide Type
Partial Recombinant Protein
Gene
APOB

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Apolipoprotein B/ApoB Protein

  • Apo B-100
  • APOB
  • ApoB-100
  • ApoB-48
  • apolipoprotein B (including Ag(x) antigen)
  • Apolipoprotein B
  • apolipoprotein B-100
  • apolipoprotein B48
  • FLDB
  • LDLCQ4
  • mutant Apo B 100

Background

This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-20454
Species: Hu
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
DPC900
Species: Hu
Applications: ELISA
NB600-610
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-46020
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB300-558
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
NBP2-10437
Species: Hu
Applications: WB
AF2009
Species: Hu
Applications: ICC, IHC
H00000338-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Apolipoprotein B/ApoB Partial Recombinant Protein (H00000338-Q01) (0)

There are no publications for Apolipoprotein B/ApoB Partial Recombinant Protein (H00000338-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein B/ApoB Partial Recombinant Protein (H00000338-Q01) (0)

There are no reviews for Apolipoprotein B/ApoB Partial Recombinant Protein (H00000338-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein B/ApoB Partial Recombinant Protein (H00000338-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein B/ApoB Products

Research Areas for Apolipoprotein B/ApoB Partial Recombinant Protein (H00000338-Q01)

Find related products by research area.

Blogs on Apolipoprotein B/ApoB

There are no specific blogs for Apolipoprotein B/ApoB, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Apolipoprotein B/ApoB Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APOB