Recombinant Human APOBEC1 Protein

Images

 
SDS-Page: Recombinant Human APOBEC1 Protein [H00000339-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human APOBEC1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human APOBEC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR

Protein/Peptide Type
Partial Recombinant Protein
Gene
APOBEC1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human APOBEC1 Protein

  • APOBEC-1
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
  • Apolipoprotein B mRNA-editing enzyme 1
  • BEDPC->U-editing enzyme APOBEC-1
  • CDAR1
  • EC 3.5.4
  • EC 3.5.4.-
  • HEPRapolipoprotein B mRNA editing enzyme complex-1

Background

APOBEC1 - apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57516
Species: Hu
Applications: WB
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-527
Species: Hu, Mu
Applications: WB
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57469
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49154
Species: Hu
Applications: IHC
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NBP1-81010
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for APOBEC1 Partial Recombinant Protein (H00000339-Q01) (0)

There are no publications for APOBEC1 Partial Recombinant Protein (H00000339-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOBEC1 Partial Recombinant Protein (H00000339-Q01) (0)

There are no reviews for APOBEC1 Partial Recombinant Protein (H00000339-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APOBEC1 Partial Recombinant Protein (H00000339-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APOBEC1 Products

Bioinformatics Tool for APOBEC1 Partial Recombinant Protein (H00000339-Q01)

Discover related pathways, diseases and genes to APOBEC1 Partial Recombinant Protein (H00000339-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOBEC1 Partial Recombinant Protein (H00000339-Q01)

Discover more about diseases related to APOBEC1 Partial Recombinant Protein (H00000339-Q01).
 

Pathways for APOBEC1 Partial Recombinant Protein (H00000339-Q01)

View related products by pathway.

PTMs for APOBEC1 Partial Recombinant Protein (H00000339-Q01)

Learn more about PTMs related to APOBEC1 Partial Recombinant Protein (H00000339-Q01).

Blogs on APOBEC1

There are no specific blogs for APOBEC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

APOBEC1 Antibody
NBP1-06977
AICDA Antibody
NBP1-30955

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human APOBEC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBEC1