Apc5 Recombinant Protein Antigen

Images

 
There are currently no images for Apc5 Recombinant Protein Antigen (NBP2-58426PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Binding Activity

Order Details

Apc5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to Apc5.

Source: E. coli

Amino Acid Sequence: ADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ANAPC5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58426.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Apc5 Recombinant Protein Antigen

  • anaphase promoting complex subunit 5
  • anaphase-promoting complex subunit 5
  • APC5Cyclosome subunit 5

Background

APC5 is a component of the anaphase-promoting complex (APC). The APC complex functions as an ubiquitin ligase that controls cell cycle progression and promotes the transition from metaphase to anaphase. The APC complex is composed of at least 11 APC components. APC5 may serve a scaffolding role that connects the enzymatic core APC subunits with the regulatory APC subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NBP1-89095
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-61889
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-77375
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-59829
Species: Hu, Mu
Applications: IP, WB
NBP2-57669
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-01128
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF4497
Species: Hu
Applications: Simple Western, WB
NBP1-90137
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20389
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77155
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-61656
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00051435-M01
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-40367
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58426PEP
Species: Hu
Applications: Binding Activity

Publications for Apc5 Recombinant Protein Antigen (NBP2-58426PEP) (0)

There are no publications for Apc5 Recombinant Protein Antigen (NBP2-58426PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apc5 Recombinant Protein Antigen (NBP2-58426PEP) (0)

There are no reviews for Apc5 Recombinant Protein Antigen (NBP2-58426PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Apc5 Recombinant Protein Antigen (NBP2-58426PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apc5 Products

Bioinformatics Tool for Apc5 Recombinant Protein Antigen (NBP2-58426PEP)

Discover related pathways, diseases and genes to Apc5 Recombinant Protein Antigen (NBP2-58426PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apc5 Recombinant Protein Antigen (NBP2-58426PEP)

Discover more about diseases related to Apc5 Recombinant Protein Antigen (NBP2-58426PEP).
 

Pathways for Apc5 Recombinant Protein Antigen (NBP2-58426PEP)

View related products by pathway.

Research Areas for Apc5 Recombinant Protein Antigen (NBP2-58426PEP)

Find related products by research area.

Blogs on Apc5

There are no specific blogs for Apc5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Apc5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ANAPC5