Apc10 Antibody

Western Blot: Apc10 Antibody [H00010393-B02P] - Analysis of ANAPC10 expression in transfected 293T cell line by ANAPC10 polyclonal antibody. Lane 1: ANAPC10 transfected lysate(20.35 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: Apc10 Antibody [H00010393-B02P] - Analysis of purified antibody to ANAPC10 on HeLa cell. (antibody concentration 10 ug/ml)

Product Discontinued

Apc10 Antibody Summary

• Immunogen: ANAPC10 (AAH05217.1, 1 a.a. - 185 a.a.) full-length human protein. MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ANAPC10
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is useful for Western Blot, Immunofluorescence

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apc10 Antibody

• anaphase promoting complex subunit 10
• anaphase-promoting complex subunit 10
• APC10DOC1
• Cyclosome subunit 10
• DKFZP564L0562

Background

APC10 (anaphase-promoting complex subunit 10) is a member of the E3 enzyme family. This protein contains a Doc domain and has a molecular weight of approximately 21 kD. The APC10 protein is located at the centrosomes and mitotic spindles throughout mitosis and the kinetochores from prophase to anaphase, and at the midbody during telophase and cytokinesis. The APC10 protein is involved in substrate recognition and acts as a processivity factor. The APC10 protein functions with other members of the APC complex as a multisubunit cell cycle ubiquitin ligase, and a regulator of sister chromatid separation by degrading securins. In addition, this protein functions in ubiquitin-dependent cyclin catabolism, metaphase/anaphase transition, and spindle elongation. The APC10 protein comprises one subunit of the anaphase promoting complex including APC1-8, and other probable complex proteins APC9-11, Cdc26, Mnd2, Swm1. The APC complex is inactivated by protein kinase A and is activated by CDC20 and Cdh1. The Poly6115 antibody has been shown to be useful for Western blotting of the human and mouse APC10 protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANAPC10
• Uniprot:
  • AAH05217.1(Human)