Recombinant Human Apc1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Apc1 Protein Summary

Description
Apc1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
ANAPC1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Apc1 Protein

  • anaphase promoting complex subunit 1
  • anaphase-promoting complex 1 (meiotic checkpoint regulator)
  • anaphase-promoting complex subunit 1
  • APC1Testis-specific gene 24 protein
  • Cyclosome subunit 1
  • Mitotic checkpoint regulator
  • TSG24MCPR

Background

ANAPC1 - anaphase promoting complex subunit 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-01128
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-20389
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-45493
Species: Hu, Mk
Applications: WB, IHC, IF
NBP2-56924
Species: Hu
Applications: ICC/IF
AF1620
Species: Mu
Applications: WB, IHC
NBP1-54465
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-90136
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Apc1 Partial Recombinant Protein (H00064682-Q01) (0)

There are no publications for Apc1 Partial Recombinant Protein (H00064682-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apc1 Partial Recombinant Protein (H00064682-Q01) (0)

There are no reviews for Apc1 Partial Recombinant Protein (H00064682-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apc1 Partial Recombinant Protein (H00064682-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apc1 Products

Apc1 H00064682-Q01

Bioinformatics Tool for Apc1 Partial Recombinant Protein (H00064682-Q01)

Discover related pathways, diseases and genes to Apc1 Partial Recombinant Protein (H00064682-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apc1 Partial Recombinant Protein (H00064682-Q01)

Discover more about diseases related to Apc1 Partial Recombinant Protein (H00064682-Q01).
 

Pathways for Apc1 Partial Recombinant Protein (H00064682-Q01)

View related products by pathway.

PTMs for Apc1 Partial Recombinant Protein (H00064682-Q01)

Learn more about PTMs related to Apc1 Partial Recombinant Protein (H00064682-Q01).
 

Research Areas for Apc1 Partial Recombinant Protein (H00064682-Q01)

Find related products by research area.

Blogs on Apc1

There are no specific blogs for Apc1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Apc1 Antibody
NBP1-77375
Apc1 Antibody
NBP1-77375
Apc1 Antibody
NBP1-77375

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Apc1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ANAPC1