AP2M1 Recombinant Protein Antigen

Images

 
There are currently no images for AP2M1 Recombinant Protein Antigen (NBP2-55860PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AP2M1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AP2M1.

Source: E. coli

Amino Acid Sequence: LLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AP2M1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55860.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AP2M1 Recombinant Protein Antigen

  • Adaptin-mu2
  • adaptor-related protein complex 2, mu 1 subunit
  • AP-2 mu chain
  • Clathrin assembly protein complex 2 medium chain
  • clathrin coat adaptor protein AP50
  • Clathrin coat assembly protein AP50
  • Clathrin coat-associated protein AP50
  • clathrin-associated/assembly/adaptor protein, medium 1
  • HA2 50 kDa subunit
  • KIAA0109
  • mu subunit
  • Plasma membrane adaptor AP-2 50 kDa protein
  • plasma membrane adaptor AP-2 50kDA protein

Background

AP2M1 is a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. It is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. It may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-04017
Species: Hu
Applications: IP, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP3-48133
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
NBP3-16602
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-89544
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-92832
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P
NBP3-48136
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
NBP3-44874
Species: Hu
Applications: IHC, WB
NBP1-87466
Species: Hu
Applications: IHC,  IHC-P
NBP1-89985
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for AP2M1 Recombinant Protein Antigen (NBP2-55860PEP) (0)

There are no publications for AP2M1 Recombinant Protein Antigen (NBP2-55860PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP2M1 Recombinant Protein Antigen (NBP2-55860PEP) (0)

There are no reviews for AP2M1 Recombinant Protein Antigen (NBP2-55860PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AP2M1 Recombinant Protein Antigen (NBP2-55860PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AP2M1 Products

Research Areas for AP2M1 Recombinant Protein Antigen (NBP2-55860PEP)

Find related products by research area.

Blogs on AP2M1

There are no specific blogs for AP2M1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AP2M1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AP2M1