AP1S2 Antibody (3B9-G5)

Images

 
Sandwich ELISA: AP1S2 Antibody (3B9-G5) [H00008905-M01] - Detection limit for recombinant GST tagged AP1S2 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3B9-G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AP1S2 Antibody (3B9-G5) Summary

Immunogen
AP1S2 (AAH01117, 1 a.a. - 157 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Specificity
AP1S2 - adaptor-related protein complex 1, sigma 2 subunit
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AP1S2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AP1S2 Antibody (3B9-G5)

  • adaptor-related protein complex 1, sigma 2 subunit
  • MGC:1902
  • SIGMA1B
  • X-linked 59

Background

Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. Transcript variants utilizing alternative polyadenylation signals exist for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-46862
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-03754
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
AF5320
Species: Hu
Applications: WB
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-32157
Species: Hu
Applications: WB, IHC-P, IP
H00008905-M01
Species: Hu
Applications: ELISA

Publications for AP1S2 Antibody (H00008905-M01) (0)

There are no publications for AP1S2 Antibody (H00008905-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP1S2 Antibody (H00008905-M01) (0)

There are no reviews for AP1S2 Antibody (H00008905-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AP1S2 Antibody (H00008905-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP1S2 Products

Bioinformatics Tool for AP1S2 Antibody (H00008905-M01)

Discover related pathways, diseases and genes to AP1S2 Antibody (H00008905-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP1S2 Antibody (H00008905-M01)

Discover more about diseases related to AP1S2 Antibody (H00008905-M01).
 

Pathways for AP1S2 Antibody (H00008905-M01)

View related products by pathway.

PTMs for AP1S2 Antibody (H00008905-M01)

Learn more about PTMs related to AP1S2 Antibody (H00008905-M01).

Blogs on AP1S2

There are no specific blogs for AP1S2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP1S2 Antibody (3B9-G5) and receive a gift card or discount.

Bioinformatics

Gene Symbol AP1S2
Entrez
OMIM
Uniprot