New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » ANO3 » ANO3 Antibodies » ANO3 Antibody

ANO3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ANO3 Antibody [NBP1-70409] - ACHN cell lysate, concentration 0.2-1 ug/ml.
Western Blot: ANO3 Antibody [NBP1-70409] - ACHN cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ANO3 Antibody Summary

Immunogen
Synthetic peptides corresponding to TMEM16C(transmembrane protein 16C) The peptide sequence was selected from the middle region of TMEM16C. Peptide sequence WWSRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIF. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANO3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against TMEM16C and was validated on Western blot.
Theoretical MW
115 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ANO3 Antibody

  • anoctamin 3
  • anoctamin-3
  • C11orf25
  • GENX-3947
  • TMEM16C

Background

TMEM16C is a multi-pass membrane proteinPotential. It belongs to the anoctamin family. TMEM16C may act as a calcium-activated chloride channel.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DOG1/TMEM16A
Antibody (OTI1C8)
NBP2-46527
Immunohistochemistry: DOG1/TMEM16A Antibody (1C8) [NBP2-46527] - Analysis of Human skin tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: DOG1/TMEM16A Antibody (1C8) [NBP2-46527] - Analysis of Human adult heart tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: DOG1/TMEM16A Antibody (1C8) [NBP2-46527] - Analysis of Human adult brain tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
ANO6 Antibody
NBP2-92052
Western Blot: ANO6 Antibody [NBP2-92052] - Analysis of extracts of various cell lines, using ANO6 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.
Species: Hu, Mu, Rt
Applications: WB
ANO7 Antibody
NBP3-17120
Immunohistochemistry-Paraffin: ANO7 Antibody [NBP3-17120] - Analysis in human prostate and lymph node tissues using Anti-ANO7 antibody. Corresponding ANO7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ANO7 Antibody [NBP3-17120] - Staining of human prostate shows high expression.
Immunohistochemistry-Paraffin: ANO7 Antibody [NBP3-17120] - Staining of human lymph node shows low expression as expected.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TMEM16K Antibody
NBP1-59667
Western Blot: TMEM16K Antibody [NBP1-59667] - 293T cells lysate, concentration 0.2-1 ug/ml.
Western Blot: TMEM16K Antibody [NBP1-59667] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: TMEM16K Antibody [NBP1-59667] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Species: Hu
Applications: WB
Cortactin Antibody
(SC61-08)
NBP2-67632
Flow Cytometry: Cortactin Antibody (SC61-08) [NBP2-67632] - Analysis of Hela cells with Cortactin antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Cortactin Antibody (SC61-08) [NBP2-67632] - Staining Cortactin in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Cortactin Antibody (SC61-08) [NBP2-67632] - Staining Cortactin in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
tropomyosin-3
Antibody (2E4)
H00007170-M02
Sandwich ELISA: tropomyosin-3 Antibody (2E4) [H00007170-M02] - Detection limit for recombinant GST tagged TPM3 is 0.1 ng/ml as a capture antibody.
Western Blot: tropomyosin-3 Antibody (2E4) [H00007170-M02] - Enrichment of tumor proteins in plasma-derived EVs and classifier performance. Immunoblot analysis of plasma-derived extracellular vesicles from adenocarcinoma cases and matched controls to demonstrate marker performance in immunoassay. Marker abundance as quantified by densitometry of western blot, lower left; ROC curve analysis of TPM3 performance based on western blot data, lower right. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/20748) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: tropomyosin-3 Antibody (2E4) [H00007170-M02] - Analysis of monoclonal antibody to TPM3 on formalin-fixed paraffin-embedded human smooth muscle. Antibody concentration 3 ug/ml.
(2 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
MUC15 Antibody
NBP3-17128
Immunohistochemistry-Paraffin: MUC15 Antibody [NBP3-17128] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: MUC15 Antibody [NBP3-17128] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: MUC15 Antibody [NBP3-17128] - Analysis in human epididymis and duodenum tissues using Anti-MUC15 antibody. Corresponding MUC15 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining in human placenta and pancreas tissues using anti-STS antibody. Corresponding STS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human placenta shows high expression.
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular): Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - An intracellular stain was performed on HepG2 cells with NB110-60531AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
Western Blot: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Detection of ApoE in human tissue lysate using NB110-60531. Lane 1: liver Lane 2: brain
Flow Cytometry: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using ApoE antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(28 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NDUFA12 Antibody
NBP1-88935
Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TRPC1 Antibody
NB100-98844
Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat brain at 1:500 dilution using Rabbit antibody to 2d extracellular loop of TRPC1: whole serum, DAPI counterstained appearing in blue.
Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat olfactory bulb at 1:500 dilution using Rabbit antibody to TRPC1: whole serum, DAPI counterstained appearing in blue.
Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat brain at 1:500 dilution using Rabbit antibody to 2d extracellular loop of TRPC1: whole serum, DAPI counterstained appearing in blue.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
ANO3 Antibody
NBP1-70409
ANO3 Antibody
Species: Hu
Applications: WB

Publications for ANO3 Antibody (NBP1-70409) (0)

There are no publications for ANO3 Antibody (NBP1-70409).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANO3 Antibody (NBP1-70409) (0)

There are no reviews for ANO3 Antibody (NBP1-70409). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANO3 Antibody (NBP1-70409) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANO3 Products

Array NBP1-70409

Bioinformatics Tool for ANO3 Antibody (NBP1-70409)

Discover related pathways, diseases and genes to ANO3 Antibody (NBP1-70409). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANO3 Antibody (NBP1-70409)

Discover more about diseases related to ANO3 Antibody (NBP1-70409).
 

Pathways for ANO3 Antibody (NBP1-70409)

View related products by pathway.

PTMs for ANO3 Antibody (NBP1-70409)

Learn more about PTMs related to ANO3 Antibody (NBP1-70409).

Blogs on ANO3

There are no specific blogs for ANO3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANO3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ANO3