Ankyrin 3 Antibody

Immunohistochemistry-Paraffin: Ankyrin 3 Antibody [NBP2-33758] - Staining of human epididymis shows membranous positivity in glandular cells.

Product Discontinued

Ankyrin 3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ENNVFHDPVDGWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANK3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Ankyrin 3 Antibody

• ankyrin G
• Ankyrin G119
• ankyrin-3
• ankyrin-G
• Node Of Ranvier

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANK3
• Uniprot:
  • Q12955(Human)