ANKRD44 Antibody - BSA Free

Western Blot: ANKRD44 Antibody [NBP1-80887] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-36

Immunohistochemistry-Paraffin: ANKRD44 Antibody [NBP1-80887] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells.

ELISA: ANKRD44 Antibody [NBP1-80887] - ELISA confirmation of secreted proteins on synovial fluid samples, from the same patients used in the transcriptome analysis. Synovial fluid from all 12 persistent and the combined group of all 11 extended and extended-to-be samples were assayed for levels of specific proteins. All 5 genes were more highly expressed by microarray in FLS of extended-to-be. All 5 proteins trended towards increased expression in the synovial fluid of extended and extended-to-be, but only CD14 and ANKRD44 differences reached significance at p-value <0.05 Image collected and cropped by CiteAb from the following publication (//ped-rheum.biomedcentral.com/articles/10.1186/s12969-017-0217-6), licensed under a CC-BY license.

ELISA: ANKRD44 Antibody [NBP1-80887] - ELISA confirmation of secreted proteins on synovial fluid samples, from the same patients used in the transcriptome analysis. Synovial fluid from all 12 persistent & the combined group of all 11 extended & extended-to-be samples were assayed for levels of specific proteins. All 5 genes were more highly expressed by microarray in FLS of extended-to-be. All 5 proteins trended towards increased expression in the synovial fluid of extended & extended-to-be, but only CD14 & ANKRD44 differences reached significance at p-value <0.05 Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29310668), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ANKRD44 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
• Predicted Species: Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRD44
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ELISA reported in scientific literature (PMID 29310668).
• Control Peptide:

  ANKRD44 Protein (NBP1-80887PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ANKRD44 Antibody - BSA Free

• ankyrin repeat domain 44
• FLJ11570
• MGC21968
• MGC70444
• PP6-ARS-BAnkyrin repeat domain-containing protein 44
• protein phosphatase 6 ankyrin repeat subunit B
• serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B
• Serine/threonine-protein phosphatase 6 regulatory subunit ARS-B

Background

Putative regulatory subunit of protein phospatase 6 (PP6) that may be involved in the recognition ofphosphoprotein substrates

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ANKRD44 Antibody (NBP1-80887)(1)

Publication using NBP1-80887

• Brescia AC, Simonds MM, McCahan SM et al. Prior to extension, Transcriptomes of fibroblast-like Synoviocytes from extended and Polyarticular juvenile idiopathic arthritis are indistinguishable. Pediatr Rheumatol Online J 2018-01-08 [PMID: 29310668] (ELISA, Human)

Bioinformatics

• Gene Symbol: ANKRD44
• Entrez:
  • 91526(Human)
• Uniprot:
  • Q8N8A2(Human)