ANKRD44 Antibody


Western Blot: ANKRD44 Antibody [NBP1-80887] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-36
Immunohistochemistry-Paraffin: ANKRD44 Antibody [NBP1-80887] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P

Order Details

ANKRD44 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
Specificity of human ANKRD44 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ELISA reported in scientific literature (PMID 29310668).
Control Peptide
ANKRD44 Protein (NBP1-80887PEP)
Read Publication using
NBP1-80887 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ANKRD44 Antibody

  • ankyrin repeat domain 44
  • FLJ11570
  • MGC21968
  • MGC70444
  • PP6-ARS-BAnkyrin repeat domain-containing protein 44
  • protein phosphatase 6 ankyrin repeat subunit B
  • serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B
  • Serine/threonine-protein phosphatase 6 regulatory subunit ARS-B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for ANKRD44 Antibody (NBP1-80887)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ELISA.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ANKRD44 Antibody (NBP1-80887) (0)

There are no reviews for ANKRD44 Antibody (NBP1-80887). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD44 Antibody (NBP1-80887) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ANKRD44 Products

Bioinformatics Tool for ANKRD44 Antibody (NBP1-80887)

Discover related pathways, diseases and genes to ANKRD44 Antibody (NBP1-80887). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ANKRD44

There are no specific blogs for ANKRD44, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ANKRD44 Antibody and receive a gift card or discount.


Gene Symbol ANKRD44