ANKRD44 Antibody

Images

 
Western Blot: ANKRD44 Antibody [NBP1-80887] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-36
Immunohistochemistry-Paraffin: ANKRD44 Antibody [NBP1-80887] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD44 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD44
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ANKRD44 Protein (NBP1-80887PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD44 Antibody

  • ankyrin repeat domain 44
  • FLJ11570
  • MGC21968
  • MGC70444
  • PP6-ARS-BAnkyrin repeat domain-containing protein 44
  • protein phosphatase 6 ankyrin repeat subunit B
  • serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B
  • Serine/threonine-protein phosphatase 6 regulatory subunit ARS-B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-93844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP2-34049
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB5074
Species: Hu
Applications: WB
NBP2-47289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2883
Species: Hu, Mu
Applications: WB, IP
NBP2-48803
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4300
Species: Hu
Applications: IHC
NB100-41419
Species: Hu
Applications: WB, IHC-P, IP
NBP1-80898
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80887
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ANKRD44 Antibody (NBP1-80887) (0)

There are no publications for ANKRD44 Antibody (NBP1-80887).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD44 Antibody (NBP1-80887) (0)

There are no reviews for ANKRD44 Antibody (NBP1-80887). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD44 Antibody (NBP1-80887) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD44 Products

Bioinformatics Tool for ANKRD44 Antibody (NBP1-80887)

Discover related pathways, diseases and genes to ANKRD44 Antibody (NBP1-80887). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ANKRD44

There are no specific blogs for ANKRD44, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD44 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD44
Entrez
Uniprot