ANKRD15 Antibody - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: ANKRD15 Antibody [NBP2-92635] - Analysis of L929 cells using ANKRD15 at dilution of 1:100. Blue: DAPI for nuclear staining.

Product Discontinued

ANKRD15 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human KANK1 (NP_055973.2). GNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQIAAGLYACTNNESTLKSIMKKKDGNKDSNGAKKNLQFVGIN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KANK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ANKRD15 Antibody - Azide and BSA Free

• ANKRD15ankyrin repeat domain 15
• Ankyrin repeat domain-containing protein 15
• KANKDKFZp451G231
• KIAA0172MGC43128
• Kidney ankyrin repeat-containing protein
• KN motif and ankyrin repeat domain-containing protein 1
• KN motif and ankyrin repeat domains 1

Background

The ANKRD15 gene encodes a protein containing four ankyrin repeat domains in its C-terminus. The suggested role for this protein is in tumorigenesis of renal cell carcinoma. Two alternatively spliced transcript variants encoding different isoforms have been iden

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: KANK1