Angiomotin like 1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETSALTVEATSSIREKVVEDPLCNFHSPNFLRISEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAIQHQATGSAGPAHPTNNFSSTENLTQEDPQMVYQSARQEPQGQEHQV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AMOTL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Angiomotin like 1 Antibody - BSA Free
Background
Angiomotin like 1 is encoded by this gene is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, PLA, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC
Publications for Angiomotin like 1 Antibody (NBP1-91665) (0)
There are no publications for Angiomotin like 1 Antibody (NBP1-91665).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Angiomotin like 1 Antibody (NBP1-91665) (0)
There are no reviews for Angiomotin like 1 Antibody (NBP1-91665).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Angiomotin like 1 Antibody (NBP1-91665) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Angiomotin like 1 Products
Research Areas for Angiomotin like 1 Antibody (NBP1-91665)
Find related products by research area.
|
Blogs on Angiomotin like 1