AMELX Antibody (3B5)

Images

 
Western Blot: AMELX Antibody (3B5) [H00000265-M03] - Analysis of AMELX expression in A-431 (Cat # L015V1).
ELISA: AMELX Antibody (3B5) [H00000265-M03] - Detection limit for recombinant GST tagged AMELX is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
3B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AMELX Antibody (3B5) Summary

Immunogen
AMELX (NP_001133, 93 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Specificity
AMELX - amelogenin (amelogenesis imperfecta 1, X-linked) (3B5)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AMELX
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00000265-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AMELX Antibody (3B5)

  • AIH1
  • ALGN
  • amelogenin (amelogenesis imperfecta 1, X-linked)
  • amelogenin (X chromosome, amelogenesis imperfecta 1)
  • amelogenin, X isoform
  • amelogenin, X-linked
  • AMGAMGL
  • AMGXamelogenesis imperfecta 1

Background

This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3026
Species: Mu
Applications: WB
MAB1142
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-62322
Species: Hu
Applications: WB
NBP1-87446
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-98264
Species: Hu
Applications: WB
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NBP2-35212
Species: Hu
NBP2-20338
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31825
Species: Hu
Applications: IHC, IHC-P

Publications for AMELX Antibody (H00000265-M03)(1)

Reviews for AMELX Antibody (H00000265-M03) (0)

There are no reviews for AMELX Antibody (H00000265-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AMELX Antibody (H00000265-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AMELX Products

Bioinformatics Tool for AMELX Antibody (H00000265-M03)

Discover related pathways, diseases and genes to AMELX Antibody (H00000265-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMELX Antibody (H00000265-M03)

Discover more about diseases related to AMELX Antibody (H00000265-M03).
 

Pathways for AMELX Antibody (H00000265-M03)

View related products by pathway.

PTMs for AMELX Antibody (H00000265-M03)

Learn more about PTMs related to AMELX Antibody (H00000265-M03).

Blogs on AMELX

There are no specific blogs for AMELX, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMELX Antibody (3B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol AMELX
OMIM