Recombinant Human ALPPL2 Protein

Images

 
SDS-Page: Recombinant Human ALPPL2 Protein [H00000251-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ALPPL2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-90 of Human ALPPL2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ALPPL2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALPPL2 Protein

  • Alkaline phosphatase Nagao isozyme
  • alkaline phosphatase, placental-like 2
  • alkaline phosphatase, placental-like
  • ALP-1
  • ALPG
  • ALPPL
  • EC 3.1.3.1
  • GCAP
  • Germ cell alkaline phosphatase
  • Nagao isozyme
  • Placental alkaline phosphatase-like
  • placental-like alkaline phosphatase
  • PLAP-like
  • testicular and thymus alkaline phosphatase

Background

ALPPL2 - alkaline phosphatase, placental-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
AF6386
Species: Hu
Applications: WB, IP
NBP1-84996
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
H00002978-R01V
Species: Hu
NB120-5422
Species: Bv
Applications: WB, ELISA, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-37387
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP2-08197
Species: Hu
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP

Publications for ALPPL2 Partial Recombinant Protein (H00000251-Q01) (0)

There are no publications for ALPPL2 Partial Recombinant Protein (H00000251-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALPPL2 Partial Recombinant Protein (H00000251-Q01) (0)

There are no reviews for ALPPL2 Partial Recombinant Protein (H00000251-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALPPL2 Partial Recombinant Protein (H00000251-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALPPL2 Products

Bioinformatics Tool for ALPPL2 Partial Recombinant Protein (H00000251-Q01)

Discover related pathways, diseases and genes to ALPPL2 Partial Recombinant Protein (H00000251-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALPPL2 Partial Recombinant Protein (H00000251-Q01)

Discover more about diseases related to ALPPL2 Partial Recombinant Protein (H00000251-Q01).
 

Pathways for ALPPL2 Partial Recombinant Protein (H00000251-Q01)

View related products by pathway.

PTMs for ALPPL2 Partial Recombinant Protein (H00000251-Q01)

Learn more about PTMs related to ALPPL2 Partial Recombinant Protein (H00000251-Q01).
 

Research Areas for ALPPL2 Partial Recombinant Protein (H00000251-Q01)

Find related products by research area.

Blogs on ALPPL2

There are no specific blogs for ALPPL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ALPPL2 Antibody (2B3)
H00000251-M07

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALPPL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALPPL2