alpha Tubulin 3c Antibody - BSA Free

Images

 
Western Blot: alpha Tubulin 3c Antibody [NBP1-53026] - Jurkat, Antibody Dilution: 1.0 ug/ml TUBA3C is supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: alpha Tubulin 3c Antibody [NBP1-53026] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: alpha Tubulin 3c Antibody [NBP1-53026] - Hela, Antibody Dilution: 1.0 ug/ml TUBA3C is supported by BioGPS gene expression data to be expressed in HeLa.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

alpha Tubulin 3c Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to TUBA3C(tubulin, alpha 3c) The peptide sequence was selected from the N terminal of TUBA3C. Peptide sequence VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUBA3C
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for alpha Tubulin 3c Antibody - BSA Free

  • alpha Tubulin 3c
  • Alpha-tubulin 2
  • Alpha-tubulin 3C/D
  • bA408E5.3
  • TUBA2
  • TUBA2Tubulin alpha-2 chain
  • TUBA3C
  • TUBA3D
  • tubulin alpha-3C/D chain
  • tubulin, alpha 2
  • tubulin, alpha 3c

Background

Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome.Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-06153
Species: Hu
Applications: IHC,  IHC-P, WB
MAB994
Species: Mu
Applications: WB
NBP1-79850
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
AF746
Species: Hu, Mu
Applications: WB
NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-17923
Species: Hu
Applications: IHC,  IHC-P
NBP2-84247
Species: Hu
Applications: WB
NB100-690
Species: Av, Bv, Ca, Ch, ChHa, Dr, Fu, Gt, Gp, Ha, Hu, Pm, Mu, Pa, Po, Pm, Rb, Rt, Xp, Ye
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, Simple Western, WB
NBP2-21604
Species: Ce, Ch, Dr, Hu, I, Mu, Pr, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
273-F9
Species: Hu
Applications: BA
AF746
Species: Hu, Mu
Applications: WB
NBP1-84307
Species: Hu
Applications: ICC/IF, WB
AF3876
Species: Hu, Mu
Applications: IHC, WB

Publications for alpha Tubulin 3c Antibody (NBP1-53026) (0)

There are no publications for alpha Tubulin 3c Antibody (NBP1-53026).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha Tubulin 3c Antibody (NBP1-53026) (0)

There are no reviews for alpha Tubulin 3c Antibody (NBP1-53026). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha Tubulin 3c Antibody (NBP1-53026) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha Tubulin 3c Products

Research Areas for alpha Tubulin 3c Antibody (NBP1-53026)

Find related products by research area.

Blogs on alpha Tubulin 3c

There are no specific blogs for alpha Tubulin 3c, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha Tubulin 3c Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBA3C