Recombinant Human alpha Glucosidase 2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human alpha Glucosidase 2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 865-957 of Human GANAB partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GANAB
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human alpha Glucosidase 2 Protein

  • Alpha-glucosidase 2
  • EC 3.2.1
  • EC 3.2.1.84
  • G2ANGLUII
  • Glucosidase II subunit alpha
  • glucosidase, alpha; neutral AB
  • GluII
  • KIAA0088alpha glucosidase II alpha subunit
  • neutral alpha-glucosidase AB

Background

GANAB - glucosidase, alpha; neutral AB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6144
Species: Hu
Applications: WB, Simple Western
AF497
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
795-P4/CF
Species: Hu
NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02609
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45464
Species: Hu
Applications: WB, IHC
NBP2-30783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NB100-2832
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for alpha Glucosidase 2 Partial Recombinant Protein (H00023193-Q01) (0)

There are no publications for alpha Glucosidase 2 Partial Recombinant Protein (H00023193-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha Glucosidase 2 Partial Recombinant Protein (H00023193-Q01) (0)

There are no reviews for alpha Glucosidase 2 Partial Recombinant Protein (H00023193-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha Glucosidase 2 Partial Recombinant Protein (H00023193-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alpha Glucosidase 2 Products

Bioinformatics Tool for alpha Glucosidase 2 Partial Recombinant Protein (H00023193-Q01)

Discover related pathways, diseases and genes to alpha Glucosidase 2 Partial Recombinant Protein (H00023193-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha Glucosidase 2 Partial Recombinant Protein (H00023193-Q01)

Discover more about diseases related to alpha Glucosidase 2 Partial Recombinant Protein (H00023193-Q01).
 

Pathways for alpha Glucosidase 2 Partial Recombinant Protein (H00023193-Q01)

View related products by pathway.

Blogs on alpha Glucosidase 2

There are no specific blogs for alpha Glucosidase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human alpha Glucosidase 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GANAB