Alpha Fodrin Recombinant Protein Antigen

Images

 
There are currently no images for Alpha Fodrin Protein (NBP1-89460PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Alpha Fodrin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPTAN1.

Source: E. coli

Amino Acid Sequence: HQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SPTAN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89460.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Alpha Fodrin Recombinant Protein Antigen

  • Alpha-II spectrin
  • EIEE5
  • FLJ17738
  • FLJ44613
  • Fodrin alpha chain
  • NEAS
  • spectrin alpha chain, brain
  • spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
  • Spectrin, non-erythroid alpha chain
  • SPTA2

Background

SPTAN1/Alpha II-spectrin is one of two polypeptide chains (alpha and beta) that are part of the fodrin tetramer. Fodrin functions to link actin filaments to the plasma membrane and is a major neuronal cytoskeletal protein. Fodrin has been linked to neurogenerative and autoimmune diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01819
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
NBP1-87122
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86088
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for Alpha Fodrin Protein (NBP1-89460PEP) (0)

There are no publications for Alpha Fodrin Protein (NBP1-89460PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alpha Fodrin Protein (NBP1-89460PEP) (0)

There are no reviews for Alpha Fodrin Protein (NBP1-89460PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Alpha Fodrin Protein (NBP1-89460PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Alpha Fodrin Products

Research Areas for Alpha Fodrin Protein (NBP1-89460PEP)

Find related products by research area.

Blogs on Alpha Fodrin

There are no specific blogs for Alpha Fodrin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Alpha Fodrin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SPTAN1