Recombinant Human ALOX12B Protein

Images

 
SDS-Page: Recombinant Human ALOX12B Protein [H00000242-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ALOX12B Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-91 of Human ALOX12B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIRKIFPGKKSVVSEYVAEHWAED

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ALOX12B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALOX12B Protein

  • 12R-LOXEC 1.13.11.-
  • arachidonate 12-lipoxygenase, 12R type
  • arachidonate 12-lipoxygenase, 12R-type
  • EC 1.13.11.33,12R-lipoxygenase
  • Epidermis-type lipoxygenase 12

Background

ALOX12B - arachidonate 12-lipoxygenase, 12R type

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29941
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32533
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00000247-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87528
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01740
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-93466
Species: Hu, Mu
Applications: ICC/IF, IP, PEP-ELISA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00000242-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ALOX12B Partial Recombinant Protein (H00000242-Q01) (0)

There are no publications for ALOX12B Partial Recombinant Protein (H00000242-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALOX12B Partial Recombinant Protein (H00000242-Q01) (0)

There are no reviews for ALOX12B Partial Recombinant Protein (H00000242-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALOX12B Partial Recombinant Protein (H00000242-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALOX12B Products

Bioinformatics Tool for ALOX12B Partial Recombinant Protein (H00000242-Q01)

Discover related pathways, diseases and genes to ALOX12B Partial Recombinant Protein (H00000242-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALOX12B Partial Recombinant Protein (H00000242-Q01)

Discover more about diseases related to ALOX12B Partial Recombinant Protein (H00000242-Q01).
 

Pathways for ALOX12B Partial Recombinant Protein (H00000242-Q01)

View related products by pathway.

PTMs for ALOX12B Partial Recombinant Protein (H00000242-Q01)

Learn more about PTMs related to ALOX12B Partial Recombinant Protein (H00000242-Q01).
 

Research Areas for ALOX12B Partial Recombinant Protein (H00000242-Q01)

Find related products by research area.

Blogs on ALOX12B

There are no specific blogs for ALOX12B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LOX Antibody
NB100-2527
ALOX12B Antibody
NBP1-89409

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALOX12B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOX12B