ALG1 Antibody


Western Blot: ALG1 Antibody [NBP1-69510] - This Anti-ALG1 antibody was used in Western Blot of NTERA2 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB

Order Details

ALG1 Antibody Summary

Synthetic peptides corresponding to ALG1(asparagine-linked glycosylation 1 homolog) The peptide sequence was selected from the N terminal of ALG1. Peptide sequence VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ALG1 and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ALG1 Antibody

  • asparagine-linked glycosylation 1 homolog (yeast, beta-1,4-mannosyltransferase)
  • asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog (S.cerevisiae)
  • Asparagine-linked glycosylation protein 1 homolog
  • beta-1,4 mannosyltransferase
  • beta-1,4-mannosyltransferase
  • chitobiosyldiphosphodolichol beta-mannosyltransferase
  • GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase
  • GDP-mannose-dolichol diphosphochitobiose mannosyltransferase
  • hMat-1
  • HMT-1
  • mannosyltransferase-1
  • MT-1


ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).The biosynthesis of lipid-linked oligosaccharides is highly conserved among eukaryotes and is catalyzed by 14 glycosyltransferases in an ordered stepwise manner. Mannosyltransferase I (MT I) catalyzes the first mannosylation step in this process.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-421 BM767933.1 1-421 422-1179 AY359073.1 416-1173 1180-1444 CA455103.1 259-523 1445-1939 CD366777.1 17-511 c 1940-2122 BC031095.1 1931-2113 2123-2149 BQ002699.1 1-27 c


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready

Publications for ALG1 Antibody (NBP1-69510) (0)

There are no publications for ALG1 Antibody (NBP1-69510).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG1 Antibody (NBP1-69510) (0)

There are no reviews for ALG1 Antibody (NBP1-69510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG1 Antibody (NBP1-69510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ALG1 Products

Bioinformatics Tool for ALG1 Antibody (NBP1-69510)

Discover related pathways, diseases and genes to ALG1 Antibody (NBP1-69510). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG1 Antibody (NBP1-69510)

Discover more about diseases related to ALG1 Antibody (NBP1-69510).

Pathways for ALG1 Antibody (NBP1-69510)

View related products by pathway.

PTMs for ALG1 Antibody (NBP1-69510)

Learn more about PTMs related to ALG1 Antibody (NBP1-69510).

Blogs on ALG1

There are no specific blogs for ALG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ALG1 Antibody and receive a gift card or discount.


Gene Symbol ALG1