AKAP7 Antibody (2B3) - Azide and BSA Free

Western Blot: AKAP7 Antibody (2B3) [H00009465-M01] - Detection against Immunogen (34.65 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2B3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

AKAP7 Antibody (2B3) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse AKAP7 Antibody (2B3) - Azide and BSA Free (H00009465-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: AKAP7 (AAH16927, 1 a.a. ~ 81 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
• Specificity: AKAP7 - A kinase (PRKA) anchor protein 7
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: AKAP7
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AKAP7 Antibody (2B3) - Azide and BSA Free

• A kinase (PRKA) anchor protein 7
• AKAP 18
• AKAP15
• AKAP18A-kinase anchor protein 7 isoform alpha
• AKAP-7 isoform gamma
• AKAP-7 isoforms alpha and beta
• A-kinase anchor protein 18 kDa
• A-kinase anchor protein 7 isoform gamma
• A-kinase anchor protein 7 isoforms alpha and beta
• A-kinase anchor protein 7
• A-kinase anchor protein 9 kDa
• A-kinase anchor protein, 18-kD
• A-kinase anchoring protein 18
• protein kinase A anchoring protein 7
• Protein kinase A-anchoring protein 7 isoform gamma
• Protein kinase A-anchoring protein 7 isoforms alpha/beta

Background

This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AKAP7
• Entrez:
  • 9465(Human)
• OMIM:
  • 604693(Human)
• Uniprot:
  • AAH16927(Human)