AKAP6 Antibody (2E8) - Azide and BSA Free

Western Blot: AKAP6 Antibody (2E8) [H00009472-M07] - Detection against Immunogen (36.52 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2E8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

AKAP6 Antibody (2E8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse AKAP6 Antibody (2E8) - Azide and BSA Free (H00009472-M07) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: AKAP6 (NP_004265.3, 2221 a.a. ~ 2318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDLSLKANQPTDKAALHPSPKTLTCEENLLNLHEKRHRNMH
• Specificity: Reacts with A kinase (PRKA) anchor protein 6.
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: AKAP6
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AKAP6 Antibody (2E8) - Azide and BSA Free

• A kinase (PRKA) anchor protein 6
• ADAP6A-kinase anchor protein 6
• AKAP100A-kinase anchor protein 100 kDa
• AKAP-6
• KIAA0311AKAP 100
• mAKAPMGC165020
• PRKA6ADAP100
• protein kinase A anchoring protein 6
• Protein kinase A-anchoring protein 6

Background

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is highly expressed in various brain regions and cardiac and skeletal muscle. It is specifically localized to the sarcoplasmic reticulum and nuclear membrane, and is involved in anchoring PKA to the nuclear membrane or sarcoplasmic reticulum. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AKAP6
• Entrez:
  • 9472(Human)
• Uniprot:
  • NP_004265(Human)