AKAP5 Antibody

Images

 
Western Blot: AKAP5 Antibody [NBP1-54807] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AKAP5 Antibody Summary

Immunogen
Synthetic peptides corresponding to AKAP5(A kinase (PRKA) anchor protein 5) The peptide sequence was selected from the middle region of AKAP5 (NP_004848). Peptide sequence KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKAP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against AKAP5 and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
From PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AKAP5 Antibody

  • A kinase (PRKA) anchor protein 5
  • AKAP 79
  • AKAP7979kDa
  • A-kinase anchor protein 79 kDa
  • A-kinase anchoring protein 75/79
  • cAMP-dependent protein kinase regulatory subunit II high affinity bindingprotein
  • cAMP-dependent protein kinase regulatory subunit II high affinity-bindingprotein
  • H21

Background

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP5 is a member of the AKAP family. It binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT.The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-02576
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF
PPS007
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
MAB2568
Species: Mu
Applications: WB, IHC
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-68211
Species: Hu
Applications: WB, IP
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54807
Species: Hu
Applications: WB

Publications for AKAP5 Antibody (NBP1-54807) (0)

There are no publications for AKAP5 Antibody (NBP1-54807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP5 Antibody (NBP1-54807) (0)

There are no reviews for AKAP5 Antibody (NBP1-54807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKAP5 Antibody (NBP1-54807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKAP5 Products

Bioinformatics Tool for AKAP5 Antibody (NBP1-54807)

Discover related pathways, diseases and genes to AKAP5 Antibody (NBP1-54807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP5 Antibody (NBP1-54807)

Discover more about diseases related to AKAP5 Antibody (NBP1-54807).
 

Pathways for AKAP5 Antibody (NBP1-54807)

View related products by pathway.

PTMs for AKAP5 Antibody (NBP1-54807)

Learn more about PTMs related to AKAP5 Antibody (NBP1-54807).

Blogs on AKAP5

There are no specific blogs for AKAP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKAP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP5
Entrez
Uniprot