Recombinant Human AKAP10 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AKAP10 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human AKAP10 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
AKAP10
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AKAP10 Protein

  • A kinase (PRKA) anchor protein 10
  • AKAP-10
  • A-kinase anchor protein 10, mitochondrial
  • D-AKAP2
  • D-AKAP-2
  • Dual specificity A kinase-anchoring protein 2
  • dual-specificity A-kinase anchoring protein 2
  • MGC9414
  • mitochondrial A kinase PPKA anchor protein 10
  • PRKA10a kinase anchor protein 10, mitochondrial
  • protein kinase A anchoring protein 10
  • Protein kinase A-anchoring protein 10

Background

AKAP10 - A kinase (PRKA) anchor protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-35213
Species: Hu
NBP1-76526
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
AF3287
Species: Hu, Mu, Rt
Applications: WB
NB400-149
Species: Hu, Mu, Bv, Rt(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-68211
Species: Hu
Applications: WB, IP
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-56659
Species: Hu, Mu, Rt
Applications: WB
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP, IF
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02520
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for AKAP10 Partial Recombinant Protein (H00011216-Q01) (0)

There are no publications for AKAP10 Partial Recombinant Protein (H00011216-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP10 Partial Recombinant Protein (H00011216-Q01) (0)

There are no reviews for AKAP10 Partial Recombinant Protein (H00011216-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKAP10 Partial Recombinant Protein (H00011216-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AKAP10 Products

Bioinformatics Tool for AKAP10 Partial Recombinant Protein (H00011216-Q01)

Discover related pathways, diseases and genes to AKAP10 Partial Recombinant Protein (H00011216-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP10 Partial Recombinant Protein (H00011216-Q01)

Discover more about diseases related to AKAP10 Partial Recombinant Protein (H00011216-Q01).
 

Pathways for AKAP10 Partial Recombinant Protein (H00011216-Q01)

View related products by pathway.

PTMs for AKAP10 Partial Recombinant Protein (H00011216-Q01)

Learn more about PTMs related to AKAP10 Partial Recombinant Protein (H00011216-Q01).

Blogs on AKAP10

There are no specific blogs for AKAP10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PDZK1 Antibody
NB400-149

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AKAP10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP10