Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody


Western Blot: TMPRSS11D Antibody [NBP1-69558] - This Anti-TMPRSS11D antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody Summary

Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected from the middle region of TMPRSS11D. Peptide sequence IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMPRSS11D and was validated on Western blot.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody

  • airway trypsin like protease
  • Airway trypsin-like protease
  • EC 3.4.21
  • EC 3.4.21.-
  • HAT
  • MGC150587
  • MGC150588
  • transmembrane protease serine 11D
  • transmembrane protease, serine 11D


TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. This gene encodes a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Hu
Species: Hu
Species: Hu
Species: Hu
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF

Publications for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-69558) (0)

There are no publications for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-69558).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-69558) (0)

There are no reviews for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-69558). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-69558) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Airway Trypsin-like Protease/HAT/TMPRSS11D Products

Bioinformatics Tool for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-69558)

Discover related pathways, diseases and genes to Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-69558). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody (NBP1-69558)

View related products by pathway.

Blogs on Airway Trypsin-like Protease/HAT/TMPRSS11D

There are no specific blogs for Airway Trypsin-like Protease/HAT/TMPRSS11D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody and receive a gift card or discount.


Gene Symbol TMPRSS11D