Recombinant Human AHNAK Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human AHNAK Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human AHNAK

Source: Wheat Germ

Amino Acid Sequence: MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTW

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
AHNAK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AHNAK Protein

  • AHNAK nucleoprotein (desmoyokin)
  • AHNAK nucleoprotein
  • AHNAK-related
  • AHNAKRS
  • desmoyokin
  • MGC5395
  • neuroblast differentiation-associated protein AHNAK
  • PM227

Background

AHNAK - AHNAK nucleoprotein (desmoyokin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66814
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89598
Species: Hu, Mu, Ca
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-49306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005097-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-34061
Species: Hu
Applications: IHC, IHC-P
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-64636
Species: Hu
NBP2-13512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
H00079026-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for AHNAK Partial Recombinant Protein (H00079026-Q01) (0)

There are no publications for AHNAK Partial Recombinant Protein (H00079026-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AHNAK Partial Recombinant Protein (H00079026-Q01) (0)

There are no reviews for AHNAK Partial Recombinant Protein (H00079026-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AHNAK Partial Recombinant Protein (H00079026-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for AHNAK Partial Recombinant Protein (H00079026-Q01)

Discover related pathways, diseases and genes to AHNAK Partial Recombinant Protein (H00079026-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AHNAK Partial Recombinant Protein (H00079026-Q01)

Discover more about diseases related to AHNAK Partial Recombinant Protein (H00079026-Q01).
 

Pathways for AHNAK Partial Recombinant Protein (H00079026-Q01)

View related products by pathway.

PTMs for AHNAK Partial Recombinant Protein (H00079026-Q01)

Learn more about PTMs related to AHNAK Partial Recombinant Protein (H00079026-Q01).
 

Research Areas for AHNAK Partial Recombinant Protein (H00079026-Q01)

Find related products by research area.

Blogs on AHNAK

There are no specific blogs for AHNAK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AHNAK Antibody (3G7)
H00079026-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AHNAK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AHNAK