AGPAT3 Antibody

Images

 
Western Blot: AGPAT3 Antibody [NBP1-74276] - Human Fetal Liver Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AGPAT3 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of AGPAT3 (NP_064517). Immunizing peptide sequence KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGPAT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against AGPAT3 and was validated on Western blot.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AGPAT3 Antibody

  • 1-acylglycerol-3-phosphate O-acyltransferase 31-acyl-sn-glycerol-3-phosphate acyltransferase gamma
  • EC 2.3.1.51
  • gene similar to plant lysophosphatidic acid acyltransferase10lysophosphatidic acid acyltransferase-gamma1
  • LPAAT-gamma
  • LPAAT-GAMMA1
  • Lysophosphatidic acid acyltransferase gamma
  • MGC4604,1-AGP acyltransferase 3,1-AGPAT 3

Background

The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82236
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-76907
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-30948
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP2-04299
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-49207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001040-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-01664
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7105
Species: Hu
Applications: WB
NBP1-88921
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-88923
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF

Publications for AGPAT3 Antibody (NBP1-74276) (0)

There are no publications for AGPAT3 Antibody (NBP1-74276).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGPAT3 Antibody (NBP1-74276) (0)

There are no reviews for AGPAT3 Antibody (NBP1-74276). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGPAT3 Antibody (NBP1-74276) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AGPAT3 Products

Bioinformatics Tool for AGPAT3 Antibody (NBP1-74276)

Discover related pathways, diseases and genes to AGPAT3 Antibody (NBP1-74276). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGPAT3 Antibody (NBP1-74276)

Discover more about diseases related to AGPAT3 Antibody (NBP1-74276).
 

Pathways for AGPAT3 Antibody (NBP1-74276)

View related products by pathway.

PTMs for AGPAT3 Antibody (NBP1-74276)

Learn more about PTMs related to AGPAT3 Antibody (NBP1-74276).

Blogs on AGPAT3

There are no specific blogs for AGPAT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGPAT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGPAT3
Entrez
Uniprot