Recombinant Human AGFG2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AGFG2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 155 of Human HRBL full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWPDTFPRRLCQL

Protein/Peptide Type
Recombinant Protein
Gene
AGFG2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AGFG2 Protein

  • ArfGAP with FG repeats 2
  • HIV-1 Rev binding protein-like
  • HIV-1 Rev-binding protein-like protein
  • HRBLnucleoporin
  • RAB-R
  • RABRarf-GAP domain and FG repeats-containing protein 2
  • Rev/Rex activation domain binding protein-related
  • Rev/Rex activation domain-binding protein related

Background

This gene is a member of the HIV-1 Rev binding protein (HRB) family and encodes a protein with one Arf-GAP zinc finger domain, several phe-gly (FG) motifs, and four asn-pro-phe (NPF) motifs. This protein interacts with Eps15 homology (EH) domains and plays a role in the Rev export pathway, which mediates the nucleocytoplasmic transfer of proteins and RNAs. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-93325
Species: Hu
Applications: WB, IP
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2244
Species: Hu
Applications: WB, ICC/IF, IHC-P, IP
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-93329
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81546
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76926
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-82520
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82525
Species: Hu
Applications: WB, IHC, IHC-P
NB100-93336
Species: Hu
Applications: WB, IP
H00003268-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for AGFG2 Recombinant Protein (H00003268-P01) (0)

There are no publications for AGFG2 Recombinant Protein (H00003268-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGFG2 Recombinant Protein (H00003268-P01) (0)

There are no reviews for AGFG2 Recombinant Protein (H00003268-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGFG2 Recombinant Protein (H00003268-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AGFG2 Products

Bioinformatics Tool for AGFG2 Recombinant Protein (H00003268-P01)

Discover related pathways, diseases and genes to AGFG2 Recombinant Protein (H00003268-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGFG2 Recombinant Protein (H00003268-P01)

Discover more about diseases related to AGFG2 Recombinant Protein (H00003268-P01).

Blogs on AGFG2.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

Customers Who Bought This Also Bought

AGFG2 Antibody
NBP1-83213

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AGFG2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AGFG2