ADPGK Antibody (1E4) - Azide and BSA Free

Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - ADPGK monoclonal antibody (M01), clone 1E4. Analysis of ADPGK expression in NIH/3T3.

Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - Analysis of ADPGK over-expressed 293 cell line, cotransfected with ADPGK Validated Chimera RNAi ( Cat # H00083440-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ADPGK monoclonal antibody (M01), clone 1E4 (Cat # H00083440-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - ADPGK monoclonal antibody (M01), clone 1E4 Analysis of ADPGK expression in HeLa.

Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - ADPGK monoclonal antibody (M01), clone 1E4. Analysis of ADPGK expression in PC-12.

Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - ADPGK monoclonal antibody (M01), clone 1E4. Analysis of ADPGK expression in Raw 264.7.

Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - Analysis of ADPGK expression in transfected 293T cell line by ADPGK monoclonal antibody (M01), clone 1E4.Lane 1: ADPGK transfected lysate(54.1 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: ADPGK Antibody (1E4) [H00083440-M01] - Detection limit for recombinant GST tagged ADPGK is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, KD, KO
• Clone: 1E4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ADPGK Antibody (1E4) - Azide and BSA Free Summary

• Immunogen: ADPGK (NP_112574, 425 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY
• Specificity: ADPGK - ADP-dependent glucokinase
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ADPGK
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Knockout Validated
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate, transfected lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. Knock Out Validation was reported in scientific literature (PMID: 23799003).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADPGK Antibody (1E4) - Azide and BSA Free

• ADP-dependent glucokinase
• ADP-GKrbBP-35
• ATP-dependent glucokinase
• DKFZp434B195
• EC 2.7.1.147,2610017G09Rik
• RbBP-35

Background

ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ADPGK Antibody (H00083440-M01)(3)

Publications using H00083440-M01

• Richter S, Morrison S, Connor T et al. Zinc finger nuclease mediated knockout of ADP-dependent glucokinase in cancer cell lines: effects on cell survival and mitochondrial oxidative metabolism. PLoS One 2013-06-14 [PMID: 23799003] (KO, Human)
• Blandin G, Marchand S, Charton K et al. A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome. Skelet Muscle 2013-02-15 [PMID: 23414517] (WB, Human)
• Richter S, Richter JP, Mehta SY et al. Expression and role in glycolysis of human ADP-dependent glucokinase. Mol Cell Biochem 2012-01-05 [PMID: 22219026]

Bioinformatics

• Gene Symbol: ADPGK
• Entrez:
  • 83440(Human)
• Uniprot:
  • NP_112574(Human)