ADAT1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ADAT1 Antibody [NBP1-86237] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ADAT1 Antibody [NBP1-86237] - Staining of human lymph node shows strong cytoplasmic positivity in germinal and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YLLHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCGDASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADAT1 Protein (NBP1-86237PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAT1 Antibody

  • adenosine deaminase acting on tRNA
  • adenosine deaminase, tRNA-specific 1
  • EC 3.5.4
  • EC 3.5.4.-
  • HADAT1
  • tRNA-specific adenosine deaminase 1
  • tRNA-specific adenosine-37 deaminase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-07321
Species: Hu
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90240
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-93325
Species: Hu
Applications: WB, IP
NBP1-87706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57136
Species: Hu
Applications: WB, ICC/IF, IHC
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84285
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-31732
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for ADAT1 Antibody (NBP1-86237) (0)

There are no publications for ADAT1 Antibody (NBP1-86237).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAT1 Antibody (NBP1-86237) (0)

There are no reviews for ADAT1 Antibody (NBP1-86237). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAT1 Antibody (NBP1-86237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAT1 Products

Bioinformatics Tool for ADAT1 Antibody (NBP1-86237)

Discover related pathways, diseases and genes to ADAT1 Antibody (NBP1-86237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAT1 Antibody (NBP1-86237)

Discover more about diseases related to ADAT1 Antibody (NBP1-86237).
 

Pathways for ADAT1 Antibody (NBP1-86237)

View related products by pathway.

PTMs for ADAT1 Antibody (NBP1-86237)

Learn more about PTMs related to ADAT1 Antibody (NBP1-86237).

Blogs on ADAT1

There are no specific blogs for ADAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAT1