Recombinant Human ADAR Protein

Images

 
SDS-Page: Recombinant Human ADAR Protein [H00000103-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ADAR Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-109 of Human ADAR partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLGSQGLQRGFQH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ADAR
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADAR Protein

  • ADAR1DSH
  • adenosine deaminase, RNA-specific
  • DRADAP136
  • DSRADadenosine deaminase acting on RNA 1-A
  • EC 3.5.4
  • EC 3.5.4.-
  • G1P1double-stranded RNA-specific adenosine deaminase
  • IFI-4
  • IFI4dsRNA adenosine deaminase
  • interferon-induced protein 4
  • Interferon-inducible protein 4
  • K88DSRBP
  • p136,136 kDa double-stranded RNA-binding protein

Background

This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90240
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-93325
Species: Hu
Applications: WB, IP
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-90238
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
AF7164
Species: Hu
Applications: WB
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
AF1620
Species: Mu
Applications: WB, IHC

Publications for ADAR Partial Recombinant Protein (H00000103-Q01) (0)

There are no publications for ADAR Partial Recombinant Protein (H00000103-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAR Partial Recombinant Protein (H00000103-Q01) (0)

There are no reviews for ADAR Partial Recombinant Protein (H00000103-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAR Partial Recombinant Protein (H00000103-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAR Products

ADAR H00000103-Q01

Bioinformatics Tool for ADAR Partial Recombinant Protein (H00000103-Q01)

Discover related pathways, diseases and genes to ADAR Partial Recombinant Protein (H00000103-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAR Partial Recombinant Protein (H00000103-Q01)

Discover more about diseases related to ADAR Partial Recombinant Protein (H00000103-Q01).
 

Pathways for ADAR Partial Recombinant Protein (H00000103-Q01)

View related products by pathway.

PTMs for ADAR Partial Recombinant Protein (H00000103-Q01)

Learn more about PTMs related to ADAR Partial Recombinant Protein (H00000103-Q01).

Blogs on ADAR

There are no specific blogs for ADAR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PKR Antibody
NBP1-77266

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADAR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAR