ADAMTS18 Recombinant Protein Antigen

Images

 
There are currently no images for ADAMTS18 Protein (NBP1-91651PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ADAMTS18 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAMTS18.

Source: E. coli

Amino Acid Sequence: VFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVST

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADAMTS18
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91651.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADAMTS18 Recombinant Protein Antigen

  • A disintegrin and metalloproteinase with thrombospondin motifs 18
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 18
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 21
  • ADAM metallopeptidase with thrombospondin type 1 motif, 18
  • ADAM-TS 18
  • ADAM-TS18
  • ADAMTS-18
  • ADAMTS21
  • disintegrin and metalloprotease-like protein
  • EC 3.4.24.-
  • EC 3.4.24.82

Background

ADAMTS18 (A disintegrin and metalloproteinase with thrombospondin motifs 18) is a 1,221 amino acid protein that is thought to function as a tumor suppressor. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. ADAMTS18 is downregulated in carcinoma cell lines by methylation of its promoter. Forced expression of ADAMTS18 in carcinoma cells can lead to significant inhibition of cell growth, suggesting that it plays a significant role as a tumor suppressor. Mutations in ADAMTS18 are the cause of Knobloch syndrome type 2 (KNO2) and ADAMTS18 has also been linked to carotid artery occlusion, vitreoretinal degeneration, retinal detachment, myopia, cataracts, nasopharyngitis, pancreatic cancer, colorectal cancer, cerebritis breast cancer, melanoma and pancreatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DNST0
Species: Hu
Applications: ELISA
AF-242-PB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP3-17147
Species: Hu
Applications: ICC/IF, WB
DADT130
Species: Hu
Applications: ELISA
DY2198-05
Species: Hu
Applications: ELISA
NBP1-89953
Species: Hu, Mu
Applications: IHC,  IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
NBP1-82916
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80694
Species: Hu
Applications: ICC/IF, WB
DY4307-05
Species: Hu
Applications: ELISA
MAB5149
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-81761
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB8209
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-15728
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45496
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-91651PEP
Species: Hu
Applications: AC

Publications for ADAMTS18 Protein (NBP1-91651PEP) (0)

There are no publications for ADAMTS18 Protein (NBP1-91651PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS18 Protein (NBP1-91651PEP) (0)

There are no reviews for ADAMTS18 Protein (NBP1-91651PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ADAMTS18 Protein (NBP1-91651PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAMTS18 Products

Blogs on ADAMTS18

There are no specific blogs for ADAMTS18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ADAMTS18 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS18