ADAMTS18 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAMTS18. Source: E. coli
Amino Acid Sequence: VFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVST Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ADAMTS18 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91651. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for ADAMTS18 Recombinant Protein Antigen
Background
ADAMTS18 (A disintegrin and metalloproteinase with thrombospondin motifs 18) is a 1,221 amino acid protein that is thought to function as a tumor suppressor. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. ADAMTS18 is downregulated in carcinoma cell lines by methylation of its promoter. Forced expression of ADAMTS18 in carcinoma cells can lead to significant inhibition of cell growth, suggesting that it plays a significant role as a tumor suppressor. Mutations in ADAMTS18 are the cause of Knobloch syndrome type 2 (KNO2) and ADAMTS18 has also been linked to carotid artery occlusion, vitreoretinal degeneration, retinal detachment, myopia, cataracts, nasopharyngitis, pancreatic cancer, colorectal cancer, cerebritis breast cancer, melanoma and pancreatitis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for ADAMTS18 Protein (NBP1-91651PEP) (0)
There are no publications for ADAMTS18 Protein (NBP1-91651PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADAMTS18 Protein (NBP1-91651PEP) (0)
There are no reviews for ADAMTS18 Protein (NBP1-91651PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for ADAMTS18 Protein (NBP1-91651PEP) (0)
Additional ADAMTS18 Products
Blogs on ADAMTS18