ADAMTS14 Antibody

Western Blot: ADAMTS14 Antibody [NBP3-10684] - Western blot analysis of ADAMTS14 in OVCAR-3 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

Product Discontinued

ADAMTS14 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADAMTS14 (NP_631894). Peptide sequence REAVQQEWAEPDGDLHNEAFGLGDLPNLLGLVGDQLGDTERKRRHAKPGS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAMTS14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 107 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ADAMTS14 Antibody

• ADAM metallopeptidase with thrombospondin type 1 motif, 14,14

Background

The ADAMTS14 gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) proteinfamily. Members of the family share several distinct protein modules, including a propeptide region, ametalloproteinase domain, a disintegrin-l

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAMTS14