ADAM7 Antibody - BSA Free

Western Blot: ADAM7 Antibody [NBP1-69366] - This Anti-ADAM7 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ADAM7 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ADAM7(ADAM metallopeptidase domain 7) The peptide sequence was selected from the C terminal of ADAM7. Peptide sequence PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAM7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 83 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ADAM7 Antibody - BSA Free

• a disintegrin and metalloproteinase domain 7
• ADAM 7
• ADAM metallopeptidase domain 7
• disintegrin and metalloproteinase domain-containing protein 7
• EAPI
• epididymal apical protein I
• GP83
• GP-83
• Sperm maturation-related glycoprotein GP-83

Background

The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-30 DB077360.1 5-34 31-396 AF215824.1 2-367 397-692 BC058037.1 466-761 693-1666 AF215824.1 664-1637 1667-2321 BC043207.2 1000-1654 2322-2612 AF215824.1 2293-2583

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAM7
• Uniprot:
  • Q9H2U9(Human)