ADAM7 Antibody

Images

 
Western Blot: ADAM7 Antibody [NBP1-69366] - This Anti-ADAM7 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAM7 Antibody Summary

Immunogen
Synthetic peptides corresponding to ADAM7(ADAM metallopeptidase domain 7) The peptide sequence was selected from the C terminal of ADAM7. Peptide sequence PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ADAM7 and was validated on Western blot.
Theoretical MW
83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ADAM7 Antibody

  • a disintegrin and metalloproteinase domain 7
  • ADAM 7
  • ADAM metallopeptidase domain 7
  • disintegrin and metalloproteinase domain-containing protein 7
  • EAPI
  • epididymal apical protein I
  • GP83
  • GP-83
  • Sperm maturation-related glycoprotein GP-83

Background

The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-30 DB077360.1 5-34 31-396 AF215824.1 2-367 397-692 BC058037.1 466-761 693-1666 AF215824.1 664-1637 1667-2321 BC043207.2 1000-1654 2322-2612 AF215824.1 2293-2583

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55995
Species: Hu
Applications: ICC/IF
H00255926-P01
Species: Hu
930-ADB
Species: Hu
NBP1-85416
Species: Hu
Applications: IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF2599
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00011086-M09
Species: Hu
Applications: WB, ELISA
MAB935
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-84938
Species: Hu
Applications: IHC, IHC-P
H00027299-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88354
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47219
Species: Hu
Applications: WB, PEP-ELISA
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP1-69366
Species: Hu
Applications: WB

Publications for ADAM7 Antibody (NBP1-69366) (0)

There are no publications for ADAM7 Antibody (NBP1-69366).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM7 Antibody (NBP1-69366) (0)

There are no reviews for ADAM7 Antibody (NBP1-69366). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM7 Antibody (NBP1-69366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM7
Uniprot