Recombinant Human ADAM33 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ADAM33 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 85 of Human ADAM33 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPVSKPDMGLVALEAEGQELLLELEKNQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ADAM33
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADAM33 Protein

  • a disintegrin and metalloprotease 33
  • a disintegrin and metalloproteinase domain 33
  • ADAM 33
  • ADAM metallopeptidase domain 33
  • ADAM33
  • C20orf153
  • chromosome 20 open reading frame 153
  • disintegrin and metalloproteinase domain-containing protein 33
  • disintegrin and reprolysin metalloproteinase family protein
  • dJ964F7.1
  • DKFZp434K0521
  • EC 3.4.24.-
  • FLJ35308
  • FLJ36751
  • MGC149823
  • MGC71889

Background

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80054
Species: Hu
Applications: WB, IHC
NBP2-01249
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-91966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-55967
Species: Hu
Applications: ICC/IF
NB500-470
Species: Hu
Applications: ELISA, Flow
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
AB-230-NA
Species: Hu
Applications: WB, Neut
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready

Publications for ADAM33 Recombinant Protein (H00080332-P01) (0)

There are no publications for ADAM33 Recombinant Protein (H00080332-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM33 Recombinant Protein (H00080332-P01) (0)

There are no reviews for ADAM33 Recombinant Protein (H00080332-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM33 Recombinant Protein (H00080332-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAM33 Products

Bioinformatics Tool for ADAM33 Recombinant Protein (H00080332-P01)

Discover related pathways, diseases and genes to ADAM33 Recombinant Protein (H00080332-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM33 Recombinant Protein (H00080332-P01)

Discover more about diseases related to ADAM33 Recombinant Protein (H00080332-P01).
 

Pathways for ADAM33 Recombinant Protein (H00080332-P01)

View related products by pathway.

PTMs for ADAM33 Recombinant Protein (H00080332-P01)

Learn more about PTMs related to ADAM33 Recombinant Protein (H00080332-P01).
 

Research Areas for ADAM33 Recombinant Protein (H00080332-P01)

Find related products by research area.

Blogs on ADAM33

There are no specific blogs for ADAM33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADAM33 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM33
Entrez