ADAM2 Antibody (1B8)

Images

 
Western Blot: ADAM2 Antibody (1B8) [H00002515-M02] - Analysis of ADAM2 expression in transfected 293T cell line by ADAM2 monoclonal antibody (M02), clone 1B8.Lane 1: ADAM2 transfected lysate (Predicted MW: 64.8 ...read more
ELISA: ADAM2 Antibody (1B8) [H00002515-M02] - Detection limit for recombinant GST tagged ADAM2 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ADAM2 Antibody (1B8) Summary

Immunogen
ADAM2 (NP_001455, 376 a.a. - 475 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ADAM2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADAM2 Antibody (1B8)

  • ADAM metallopeptidase domain 2
  • Cancer/testis antigen 15
  • CRYN2
  • CT15ADAM 2
  • disintegrin and metalloproteinase domain-containing protein 2
  • EC 3.4.24
  • fertilin beta
  • Fertilin subunit beta
  • FTNBCRYN1
  • PH-30
  • PH-30b
  • PH30PH30-beta

Background

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37395
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00255926-P01
Species: Hu
MAB935
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP2-33278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1334
Species: Hu, Mu, Po, Bv, Ca
Applications: PEP-ELISA
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready

Publications for ADAM2 Antibody (H00002515-M02) (0)

There are no publications for ADAM2 Antibody (H00002515-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM2 Antibody (H00002515-M02) (0)

There are no reviews for ADAM2 Antibody (H00002515-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM2 Antibody (H00002515-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAM2 Products

Bioinformatics Tool for ADAM2 Antibody (H00002515-M02)

Discover related pathways, diseases and genes to ADAM2 Antibody (H00002515-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM2 Antibody (H00002515-M02)

Discover more about diseases related to ADAM2 Antibody (H00002515-M02).
 

Pathways for ADAM2 Antibody (H00002515-M02)

View related products by pathway.

PTMs for ADAM2 Antibody (H00002515-M02)

Learn more about PTMs related to ADAM2 Antibody (H00002515-M02).

Blogs on ADAM2

There are no specific blogs for ADAM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM2 Antibody (1B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM2
Uniprot