![Western Blot: ADA2a Antibody [NBP2-86956] - WB Suggested Anti-TADA2L Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate](http://images.novusbio.com/fullsize2/ADA2a-Antibody-Western-Blot-NBP2-86956-img0001.jpg "Western Blot: ADA2a Antibody [NBP2-86956] - WB Suggested Anti-TADA2L Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ADA2a. Peptide sequence: LEYKSALLNECNKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKG The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TADA2A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot: KAT2A/GCN5 Antibody [NBP2-17017] - Sample (30 ug of whole cell lysate) A: IMR32 7. 5% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/KAT2A-GCN5-Antibody-Western-Blot-NBP2-17017-img0001.jpg)
![Western Blot: KAT2A/GCN5 Antibody [NBP2-17017] - Sample (30 ug of whole cell lysate) A: NIH-3T3 B: JC C: BCL-1 7. 5% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/KAT2A-GCN5-Antibody-Western-Blot-NBP2-17017-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: KAT2A/GCN5 Antibody [NBP2-17017] - Analysis of paraformaldehyde-fixed MCF-7, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/KAT2A-GCN5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-17017-img0003.jpg)
![Western Blot: TATA binding protein TBP Antibody [NBP3-13174] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with TATA binding protein TBP antibody (NBP3-13174) diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/TATA-binding-protein-TBP-Antibody-Western-Blot-NBP3-13174-img0001.jpg)
![Immunohistochemistry-Paraffin: TATA binding protein TBP Antibody [NBP3-13174] - TATA binding protein TBP antibody detects TATA binding protein TBP protein at nucleus by immunohistochemical analysis. Sample: Paraffin-embedded mouse testis. TATA binding protein TBP stained by TATA binding protein TBP antibody (NBP3-13174) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min](http://images.novusbio.com/images2/TATA-binding-protein-TBP-Antibody-Immunohistochemistry-Paraffin-NBP3-13174-img0002.jpg)
![Immunohistochemistry-Paraffin: TATA binding protein TBP Antibody [NBP3-13174] - TATA binding protein TBP antibody detects TATA binding protein TBP protein at nucleus by immunohistochemical analysis. Sample: Paraffin-embedded mouse ovary. TATA binding protein TBP stained by TATA binding protein TBP antibody (NBP3-13174) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min](http://images.novusbio.com/images2/TATA-binding-protein-TBP-Antibody-Immunohistochemistry-Paraffin-NBP3-13174-img0003.jpg)
![Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.](http://images.novusbio.com/images2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Western-Blot-NBP1-30141-img0012.jpg)
![Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Representative Western blot showing M-track protein protein proximity signals obtained for Kic1. Hog1-protA-H3: background control, Nup2: positive control. Below: Proximity signals. n = 3 replicates per sample except when indicated differently. Ratios are log2-transformed. Black lines indicate average proximity signal. Proximity signals that differ significantly from background are marked in green (q 0.01) filled circles. Grey filled triangles: q > 0.05. N: N-terminal HKMTmyc fusion. Image collected and cropped by CiteAb from the following publication (https://biosignaling.biomedcentral.com/articles/10.1186/s12964-019-0381-z), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Western-Blot-NBP1-30141-img0013.jpg)
![Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Analysis of Histone H3 K9-me3 in HeLa histone lysates. Observed molecular weight is ~15 kDa.](http://images.novusbio.com/images2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Western-Blot-NBP1-30141-img0004.jpg)
![ELISA: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)](http://images.novusbio.com/images2/SMARCA1-Antibody-(2H7B8)-ELISA-NBP2-61879-img0001.jpg)
![Flow Cytometry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of NIH/3T3 cells using SMARCA1 mouse mAb (green) and negative control (red).](http://images.novusbio.com/images2/SMARCA1-Antibody-(2H7B8)-Flow-Cytometry-NBP2-61879-img0002.jpg)
![Immunohistochemistry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of paraffin-embedded esophageal cancer tissues using SMARCA1 mouse mAb with DAB staining.](http://images.novusbio.com/images2/SMARCA1-Antibody-(2H7B8)-Immunohistochemistry-NBP2-61879-img0003.jpg)
![Western Blot: HIST1H4F Overexpression Lysate (Adult Normal) [NBP2-07996] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HIST1H4F.](http://images.novusbio.com/images/HIST1H4F-Overexpression-Lysate-(Adult-Normal)-Western-Blot-NBP2-07996-img0001.jpg)
![ELISA: H4/n Antibody (3E7H2) [NBP2-52486] - Black line: Control Antigen (100 ng); Purple line: Antigen(10ng); Blue line: Antigen (50 ng); Red line: Antigen (100 ng).](http://images.novusbio.com/images2/H4-n-Antibody-(3E7H2)-ELISA-NBP2-52486-img0008.jpg)
![Western Blot: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis using HIST2H4A(20Me) mouse mAb against THP-1 (1) cell lysate.](http://images.novusbio.com/images2/H4-n-Antibody-(3E7H2)-Western-Blot-NBP2-52486-img0009.jpg)
![Flow Cytometry: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis of Raji cells using HIST2H4A(20Me) mouse mAb (green) and negative control (red).](http://images.novusbio.com/images2/H4-n-Antibody-(3E7H2)-Flow-Cytometry-NBP2-52486-img0001.jpg)
![Immunohistochemistry: SPT3 Antibody (OTI1A5) [NBP2-45466] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/SPT3-Antibody-(OTI1A5)-Immunohistochemistry-NBP2-45466-img0001.jpg)
![Immunohistochemistry: SPT3 Antibody (OTI1A5) [NBP2-45466] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/SPT3-Antibody-(OTI1A5)-Immunohistochemistry-NBP2-45466-img0002.jpg)
![Immunohistochemistry: SPT3 Antibody (OTI1A5) [NBP2-45466] - Analysis of Adenocarcinoma of Human endometrium tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/SPT3-Antibody-(OTI1A5)-Immunohistochemistry-NBP2-45466-img0003.jpg)
![Immunohistochemistry-Paraffin: Galectin-4 Antibody (9Z2B5) [NBP3-16249] - Immunohistochemistry of paraffin-embedded human appendix using Galectin-4 Rabbit mAb (NBP3-16249) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/images2/Galectin-4-Antibody-(9Z2B5)-Immunohistochemistry-Paraffin-NBP3-16249-img0001.jpg)
![Immunohistochemistry-Paraffin: Galectin-4 Antibody (9Z2B5) [NBP3-16249] - Immunohistochemistry of paraffin-embedded mouse colon using Galectin-4 Rabbit mAb (NBP3-16249) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/images2/Galectin-4-Antibody-(9Z2B5)-Immunohistochemistry-Paraffin-NBP3-16249-img0002.jpg)
![Immunohistochemistry: Galectin-4 Antibody (9Z2B5) [NBP3-16249] - Immunofluorescence analysis of rat rectum using Galectin-4 Rabbit mAb (NBP3-16249) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/images2/Galectin-4-Antibody-(9Z2B5)-Immunohistochemistry-NBP3-16249-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for ADA2a Antibody (NBP2-86956)Discover more about diseases related to ADA2a Antibody (NBP2-86956).
| Pathways for ADA2a Antibody (NBP2-86956)View related products by pathway.
|
PTMs for ADA2a Antibody (NBP2-86956)Learn more about PTMs related to ADA2a Antibody (NBP2-86956).
| Research Areas for ADA2a Antibody (NBP2-86956)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TADA2A |
![Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/Adenosine-Deaminase-ADA-Antibody-Immunohistochemistry-Paraffin-NBP1-87404-img0016.jpg)
![Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/Adenosine-Deaminase-ADA-Antibody-Immunohistochemistry-Paraffin-NBP1-87404-img0017.jpg)
![Immunocytochemistry/Immunofluorescence: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/Adenosine-Deaminase-ADA-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87404-img0013.jpg)
![Immunohistochemistry: TADA3L Antibody [NBP1-90243] - PCAF,TADA3L, and PACS1 protein expression is reduced in human gastric tumor tissue. A tissue microarray (TMA) containing gastric tumor tissue (Tumor) and non-malignant gastric tissue (NM), was immunostained for ADA3. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41419-018-0470-8), licensed under a CC-BY licence.](http://images.novusbio.com/images2/TADA3L-Antibody-Immunohistochemistry-NBP1-90243-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: TADA3L Antibody [NBP1-90243] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/images2/TADA3L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90243-img0007.jpg)
![Immunohistochemistry-Paraffin: TADA3L Antibody [NBP1-90243] - Staining of human vagina shows strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/images2/TADA3L-Antibody-Immunohistochemistry-Paraffin-NBP1-90243-img0002.jpg)
![Immunohistochemistry-Paraffin: ADA2 beta Antibody (1C8) [H00093624-M08] - Analysis of monoclonal antibody to MGC21874 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1.5 ug/ml](http://images.novusbio.com/images2/ADA2-beta-Antibody-(1C8)-Immunohistochemistry-Paraffin-H00093624-M08-img0008.jpg)
![Sandwich ELISA: ADA2 beta Antibody (1C8) [H00093624-M08] - Detection limit for recombinant GST tagged MGC21874 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/images2/ADA2-beta-Antibody-(1C8)-Sandwich-ELISA-H00093624-M08-img0009.jpg)
![Western Blot: ADA2 beta Antibody (1C8) [H00093624-M08] - Analysis of MGC21874 expression in HeLa (Cat # L013V1).](http://images.novusbio.com/images2/ADA2-beta-Antibody-(1C8)-Western-Blot-H00093624-M08-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: PCAF Antibody (5E11) [H00008850-M04] - Analysis of monoclonal antibody to PCAF on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/PCAF-Antibody-(5E11)-Immunocytochemistry-Immunofluorescence-H00008850-M04-img0008.jpg)
![Sandwich ELISA: PCAF Antibody (5E11) [H00008850-M04] - Detection limit for recombinant GST tagged PCAF is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/images2/PCAF-Antibody-(5E11)-Sandwich-ELISA-H00008850-M04-img0009.jpg)
![Western Blot: PCAF Antibody (5E11) [H00008850-M04] - Analysis of PCAF expression in LNCaP (Cat # L004V1).](http://images.novusbio.com/images2/PCAF-Antibody-(5E11)-Western-Blot-H00008850-M04-img0010.jpg)
![Immunohistochemistry-Paraffin: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells.](http://images.novusbio.com/images2/Adenosine-Deaminase-2-CECR1-Antibody-Immunohistochemistry-Paraffin-NBP1-89238-img0012.jpg)
![Immunohistochemistry-Paraffin: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/images2/Adenosine-Deaminase-2-CECR1-Antibody-Immunohistochemistry-Paraffin-NBP1-89238-img0013.jpg)
![Immunohistochemistry-Paraffin: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/images2/Adenosine-Deaminase-2-CECR1-Antibody-Immunohistochemistry-Paraffin-NBP1-89238-img0014.jpg)
![Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Mouse tissue (50 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with SRC1 antibody [1135] diluted at 1:2000.](http://images.novusbio.com/images2/SRC1-Antibody-(1135-H4)-Western-Blot-NB200-310-img0003.jpg)
![Immunohistochemistry: NCOA2 Antibody [NB100-1756] - Sample : FFPE section of prostate adenocarcinoma. Antibody : Affinity purified rabbit anti-NCOA2/SRC2 used at a dilution of 1:100. Detection : DAB](http://images.novusbio.com/images2/NCOA2-Antibody-Immunohistochemistry-NB100-1756-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: NCOA2 Antibody [NB100-1756] - The majority of estradiol-induced PR-A or PR-B cells in the VMN of female mice coexpress SRC-1 and SRC-2. Representative image taken from vehicle control wt mice Insets show the magnified image of an area within the small square box. Magnification: images, 400x; insets, 630x. Scale bar, 50um. Image collected and cropped by CiteAb from the following publication (eneuro.sfn.org/cgi/doi/10.1523/ENEURO.0012-15.2015), licensed under a CC-BY licence.](http://images.novusbio.com/images2/NCOA2-Antibody-Immunocytochemistry-Immunofluorescence-NB100-1756-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: NCOA2 Antibody [NB100-1756] - The majority of estradiol-induced PR-A or PR-B cells in the VMN of female mice coexpress SRC-1 and SRC-2. Representative images taken from estradiol-treated wt mice. Magnification: images, 400x; insets, 630x. Scale bar, 50um. Image collected and cropped by CiteAb from the following publication (eneuro.sfn.org/cgi/doi/10.1523/ENEURO.0012-15.2015), licensed under a CC-BY licence.](http://images.novusbio.com/images2/NCOA2-Antibody-Immunocytochemistry-Immunofluorescence-NB100-1756-img0005.jpg)
![Western Blot: NCOR1 Antibody [NB100-58824] - Whole cell lysate (50 ug) from HEK293T, K-562, and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-NCoR antibodyused for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3minutes.](http://images.novusbio.com/images2/NCOR1-Antibody-Western-Blot-NB100-58824-img0002.jpg)
![Immunoprecipitation: NCOR1 Antibody [NB100-58824] - Detection of Human NCOR on HeLa whole cell lysate using NB100-5882. NCOR was also immunoprecipitated by rabbit anti-NCOR antibody NB100-58825.](http://images.novusbio.com/images2/NCOR1-Antibody-Immunoprecipitation-NB100-58824-img0001.jpg)
![Chromatin Immunoprecipitation Sequencing: NCOR1 Antibody [NB100-58824] - Localization of NCoR Binding Sites by ChIP-sequencing. Chromatin from K562 cells was immunoprecipitated with anti-NCoR antibody NB100-58824 and analyzed by DNA sequencing. The figure illustrates the peak distribution of NCoR binding within a 650 Kb region of the human X chromosome as detected using anti-NCoR antibody NB100-58824. ChIP-seq validation performed by Diogenode, Denville, NJ.](http://images.novusbio.com/images2/NCOR1-Antibody-Chromatin-Immunoprecipitation-Sequencing-NB100-58824-img0003.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")