ADA2a Antibody

Images

 
Western Blot: ADA2a Antibody [NBP2-86956] - WB Suggested Anti-TADA2L Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADA2a Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ADA2a. Peptide sequence: LEYKSALLNECNKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TADA2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADA2a Antibody

  • ADA2AFLJ12705
  • ADA2-like protein
  • hADA2
  • TADA2LADA2
  • transcriptional adapter 2-alpha
  • Transcriptional adapter 2-like
  • transcriptional adaptor 2 (ADA2 homolog, yeast)-like
  • transcriptional adaptor 2 alpha
  • transcriptional adaptor 2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-17017
Species: Hu, Mu
Applications: ICC/IF, WB
H00117143-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-90243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
2695-SE
Species: Hu
Applications: EnzAct
H00093624-M08
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00008850-M04
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-89238
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45466
Species: Hu, Mu, Rt
Applications: IHC, PAGE, WB
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF7365
Species: Hu, Mu, Rt
Applications: WB
NB100-58824
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IP, WB
NBP3-16249
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-86956
Species: Hu
Applications: WB

Publications for ADA2a Antibody (NBP2-86956) (0)

There are no publications for ADA2a Antibody (NBP2-86956).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADA2a Antibody (NBP2-86956) (0)

There are no reviews for ADA2a Antibody (NBP2-86956). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADA2a Antibody (NBP2-86956) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADA2a Products

Bioinformatics Tool for ADA2a Antibody (NBP2-86956)

Discover related pathways, diseases and genes to ADA2a Antibody (NBP2-86956). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADA2a Antibody (NBP2-86956)

Discover more about diseases related to ADA2a Antibody (NBP2-86956).
 

Pathways for ADA2a Antibody (NBP2-86956)

View related products by pathway.

PTMs for ADA2a Antibody (NBP2-86956)

Learn more about PTMs related to ADA2a Antibody (NBP2-86956).
 

Research Areas for ADA2a Antibody (NBP2-86956)

Find related products by research area.

Blogs on ADA2a

There are no specific blogs for ADA2a, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADA2a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TADA2A