ACYP1 Antibody

Images

 
Western Blot: ACYP1 Antibody [NBP1-86314] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: ACYP1 Antibody [NBP1-86314] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: ACYP1 Antibody [NBP1-86314] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACYP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACYP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACYP1 Protein (NBP1-86314PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACYP1 Antibody

  • acylphosphatase 1, erythrocyte (common) type
  • Acylphosphatase, erythrocyte isozyme
  • Acylphosphatase, organ-common type isozyme
  • Acylphosphate phosphohydrolase 1
  • ACYPEacylphosphatase-1
  • EC 3.6.1.7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83954
Species: Hu
Applications: IHC, IHC-P
NBP1-89716
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84938
Species: Hu
Applications: IHC, IHC-P
NBP2-13860
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32442
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP2-31775
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46222
Species: Hu
Applications: WB, IHC, IF
NBP1-82027
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF6637
Species: Mu
Applications: WB, IHC
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
21720002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-21008
Species: Hu
Applications: WB
NBP2-26506
Species: Hu, Mu, Rt
AF2988
Species: Mu, Rt
Applications: WB
NBP2-57788
Species: Hu
Applications: ICC/IF
AF3850
Species: Hu
Applications: WB

Publications for ACYP1 Antibody (NBP1-86314) (0)

There are no publications for ACYP1 Antibody (NBP1-86314).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACYP1 Antibody (NBP1-86314) (0)

There are no reviews for ACYP1 Antibody (NBP1-86314). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACYP1 Antibody (NBP1-86314) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACYP1 Products

Bioinformatics Tool for ACYP1 Antibody (NBP1-86314)

Discover related pathways, diseases and genes to ACYP1 Antibody (NBP1-86314). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACYP1 Antibody (NBP1-86314)

Discover more about diseases related to ACYP1 Antibody (NBP1-86314).
 

Pathways for ACYP1 Antibody (NBP1-86314)

View related products by pathway.

PTMs for ACYP1 Antibody (NBP1-86314)

Learn more about PTMs related to ACYP1 Antibody (NBP1-86314).

Blogs on ACYP1

There are no specific blogs for ACYP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACYP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACYP1