ACTL7A Antibody - BSA Free

Western Blot: ACTL7A Antibody [NBP3-10804] - Western blot analysis of ACTL7A in Human Mesenchymoma Tumor lysates. Antibody dilution at 1ug/ml

Product Discontinued

ACTL7A Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACTL7A (NP_006678.1). Peptide sequence GYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVH
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACTL7A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ACTL7A Antibody - BSA Free

• actin-like 7A
• actin-like 7-alpha
• actin-like protein 7A
• actin-like-7-alpha

Background

ACTL7A is part of the actin-related proteins family, which are involved in a variety of cellular processes, nuclear functions and cytoskeleton activities. The exact function of ACTL7A is unknown but it has been shown to interact with TES, SOCS6 and ARPC3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACTL7A