ACAD10 Antibody

Images

 
Western Blot: ACAD10 Antibody [NBP2-82564] - Host: Rabbit. Target Name: ACAD10. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACAD10 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACAD10. Peptide sequence: LKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEV The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (93%), Equine (93%), Rabbit (93%), Bovine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ACAD10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACAD10 Antibody

  • ACAD-10
  • acyl-CoA dehydrogenase family member 10
  • acyl-CoA dehydrogenase family, member 10
  • acyl-Coenzyme A dehydrogenase family, member 10
  • EC 1.3.99.-
  • MGC5601

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82749
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-14255
Species: Hu
Applications: IHC, IHC-P
NBP2-71055
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80447
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89289
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00000037-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-82564
Species: Hu, Mu, Rt, Bv, Eq, Rb
Applications: WB

Publications for ACAD10 Antibody (NBP2-82564) (0)

There are no publications for ACAD10 Antibody (NBP2-82564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAD10 Antibody (NBP2-82564) (0)

There are no reviews for ACAD10 Antibody (NBP2-82564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACAD10 Antibody (NBP2-82564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACAD10 Products

Bioinformatics Tool for ACAD10 Antibody (NBP2-82564)

Discover related pathways, diseases and genes to ACAD10 Antibody (NBP2-82564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAD10 Antibody (NBP2-82564)

Discover more about diseases related to ACAD10 Antibody (NBP2-82564).
 

Pathways for ACAD10 Antibody (NBP2-82564)

View related products by pathway.

PTMs for ACAD10 Antibody (NBP2-82564)

Learn more about PTMs related to ACAD10 Antibody (NBP2-82564).
 

Research Areas for ACAD10 Antibody (NBP2-82564)

Find related products by research area.

Blogs on ACAD10

There are no specific blogs for ACAD10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAD10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAD10