Recombinant Human ABLIM1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ABLIM1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 637 - 736 of Human ABLIM1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ABLIM1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ABLIM1 Protein

  • ABLIM
  • abLIM-1
  • actin binding LIM protein 1
  • Actin-binding double zinc finger protein
  • actin-binding double-zinc-finger protein
  • actin-binding LIM protein 1
  • Actin-binding LIM protein family member 1
  • DKFZp781D0148
  • FLJ14564
  • KIAA0059
  • LIM actin-binding protein 1
  • LIMAB1MGC1224
  • LIMATIN

Background

ABLIM1 - actin binding LIM protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-81370
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81471
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85007
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45641
Species: Hu
Applications: WB, IHC
NBP1-47745
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
H00000072-D01P
Species: Hu
Applications: WB
NBP1-76845
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF

Publications for ABLIM1 Partial Recombinant Protein (H00003983-Q01) (0)

There are no publications for ABLIM1 Partial Recombinant Protein (H00003983-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABLIM1 Partial Recombinant Protein (H00003983-Q01) (0)

There are no reviews for ABLIM1 Partial Recombinant Protein (H00003983-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABLIM1 Partial Recombinant Protein (H00003983-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABLIM1 Products

Bioinformatics Tool for ABLIM1 Partial Recombinant Protein (H00003983-Q01)

Discover related pathways, diseases and genes to ABLIM1 Partial Recombinant Protein (H00003983-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABLIM1 Partial Recombinant Protein (H00003983-Q01)

Discover more about diseases related to ABLIM1 Partial Recombinant Protein (H00003983-Q01).
 

Pathways for ABLIM1 Partial Recombinant Protein (H00003983-Q01)

View related products by pathway.

PTMs for ABLIM1 Partial Recombinant Protein (H00003983-Q01)

Learn more about PTMs related to ABLIM1 Partial Recombinant Protein (H00003983-Q01).

Blogs on ABLIM1

There are no specific blogs for ABLIM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABLIM1 Antibody
NBP1-89303
AICDA Antibody
NBP1-30955

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ABLIM1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABLIM1