Recombinant Human ABHD4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ABHD4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-342 of Human ABHD4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD

Protein/Peptide Type
Recombinant Protein
Gene
ABHD4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ABHD4 Protein

  • ABH4
  • abhydrolase domain containing 4
  • abhydrolase domain-containing protein 4
  • Alpha/beta-hydrolase 4
  • EC 3.1.1.-
  • FLJ12816
  • Lyso-N-acylphosphatidylethanolamine lipase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69654
Species: Hu
Applications: WB, IHC, IHC-P
NB110-80070
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
AF4886
Species: Mu
Applications: WB, IP
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NB300-606
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-62723
Species: Hu
Applications: WB
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14283
Species: Hu
Applications: WB, IHC, IHC-P
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB3428
Species: Hu
Applications: WB, IHC
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-230
Species: Hu
Applications: WB, IP, PLA

Publications for ABHD4 Recombinant Protein (H00063874-P01) (0)

There are no publications for ABHD4 Recombinant Protein (H00063874-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABHD4 Recombinant Protein (H00063874-P01) (0)

There are no reviews for ABHD4 Recombinant Protein (H00063874-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABHD4 Recombinant Protein (H00063874-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABHD4 Products

Bioinformatics Tool for ABHD4 Recombinant Protein (H00063874-P01)

Discover related pathways, diseases and genes to ABHD4 Recombinant Protein (H00063874-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABHD4 Recombinant Protein (H00063874-P01)

Discover more about diseases related to ABHD4 Recombinant Protein (H00063874-P01).
 

Pathways for ABHD4 Recombinant Protein (H00063874-P01)

View related products by pathway.

PTMs for ABHD4 Recombinant Protein (H00063874-P01)

Learn more about PTMs related to ABHD4 Recombinant Protein (H00063874-P01).
 

Research Areas for ABHD4 Recombinant Protein (H00063874-P01)

Find related products by research area.

Blogs on ABHD4

There are no specific blogs for ABHD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABHD4 Antibody
NBP1-83711

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ABHD4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABHD4