ABCD4 Recombinant Protein Antigen

Images

 
There are currently no images for ABCD4 Protein (NBP1-83954PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ABCD4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCD4.

Source: E. coli

Amino Acid Sequence: TLVSKNAFVCIYLISCFTQLIDLSTTLSDVAGYTHRIGQLRETLLDMSLKSQDCEILGESEWGLDTPPGWPAAEPADTAFLLERVSISAPSSDKPLIKDLSLKISEGQSLLITGNTGTGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCD4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83954.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCD4 Recombinant Protein Antigen

  • ATP-binding cassette sub-family D member 4
  • ATP-binding cassette, sub-family D (ALD), member 4
  • EST352188
  • P70R69 kDa peroxisomal ABC-transporter
  • Peroxisomal membrane protein 1-like
  • Peroxisomal membrane protein 69
  • PMP69P79R
  • PMP70-related protein
  • PXMP1-L
  • PXMP1LABC41

Background

ABCD4 is encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis. Alternative splicing results in at least two different transcript variants, one which is protein-coding and one which is probably not protein-coding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46476
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, KO, WB
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-48249
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NBP2-30876
Species: Hu
Applications: IHC,  IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NB400-163
Species: Mu
Applications: Flow, IHC,  IHC-P, WB
NB400-116
Species: Hu, Pm
Applications: ICC/IF, IP, WB
NBP1-89314
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
NB400-115
Species: Hu, Mu, Ye
Applications: ICC/IF, KD, Simple Western, WB
NBP1-32925
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-52575
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-84476
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
H00010908-M08
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB

Publications for ABCD4 Protein (NBP1-83954PEP) (0)

There are no publications for ABCD4 Protein (NBP1-83954PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCD4 Protein (NBP1-83954PEP) (0)

There are no reviews for ABCD4 Protein (NBP1-83954PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCD4 Protein (NBP1-83954PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCD4 Products

Blogs on ABCD4

There are no specific blogs for ABCD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCD4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCD4