AAK1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

AAK1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AAK1.
  
  

  Source: E. coli

  Amino Acid Sequence: LLNKDFAKLGEGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFIPLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIGKVIISVSSVMHDMCA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: AAK1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84110.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AAK1 Recombinant Protein Antigen

• AAK1
• Adaptor-associated kinase 1
• AP2 associated kinase 1
• AP2-associated protein kinase 1
• DKFZp686F03202
• DKFZp686K16132
• EC 2.7.11.1
• FLJ23712
• FLJ25931
• FLJ31060
• FLJ45252
• KIAA1048FLJ42882
• MGC138170
• MGC164568
• MGC164570

Background

AAK1 (AP2-associated kinase 1) is a Ser/Thr protein kinase. The rat homolog was first identified in a screen of a rat brain cDNA library using a domain of the alpha subunit of the heterotetrameric AP2 complex as bait. The AP2 complex is one of two major coat proteins of endocytic vesicles that function in receptor-mediated endocytosis and the recycling of synaptic vesicles. AAK1 is responsible for phosphorylating the mu subunit of AP2 to promote clathrin-mediated endocytosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: AAK1