5-HT3E Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

5-HT3E Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HTR3E.
  
  

  Source: E. coli

  Amino Acid Sequence: LAFILSRATPRPALGPLSYREHRVALLHLTHSMSTTGRGVTFTINCSGF

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: HTR3E
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33578.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 5-HT3E Recombinant Protein Antigen

• 5-HT3 receptor subunit E splice variant HTR3Ea
• 5-HT3c1
• 5-HT3c1,5-HT3E
• 5HT3E
• 5-HT3E
• 5-hydroxytryptamine (serotonin) receptor 3, family member E
• 5-hydroxytryptamine receptor 3E
• HTR3E
• MGC120035
• MGC120036
• serotonin receptor 3E

Background

The product of the HTR3E gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes a subunit E ofthe type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, ahormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encodingsubunits C, D and E form a cluster on chromosome 3. An alternative splice variant has been described but its fulllength sequence has not been determined. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: HTR3E